KEGG   Escherichia coli K-12 DH10B: ECDH10B_3747Help
Entry
ECDH10B_3747      CDS       T00666                                 

Gene name
xylF
Definition
(GenBank) D-xylose transporter subunit; periplasmic-binding component of ABC superfamily
  KO
K10543  
D-xylose transport system substrate-binding protein
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ABC transporters
Module
D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECDH10B_3747 (xylF)
Transporters [BR:ecd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    ECDH10B_3747 (xylF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3826731..3827723
Genome map
AA seq 330 aa AA seqDB search
MKIKNILLTLCTSLLLTNVAAHAKEVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFV
QSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDAD
IDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGK
IKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVA
ISGQDADLAGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQEPKADTTLNNGLKDV
PSRLLTPIDVNKNNIKDTVIKDGFHKESEL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagaacattctactcaccctttgcacctcactcctgcttaccaacgttgct
gcacacgccaaagaagtcaaaataggtatggcgattgatgatctccgtcttgaacgctgg
caaaaagatcgagatatctttgtgaaaaaggcagaatctctcggcgcgaaagtatttgta
cagtctgcaaatggcaatgaagaaacacaaatgtcgcagattgaaaacatgataaaccgg
ggtgtcgatgttcttgtcattattccgtataacggtcaggtattaagtaacgttgtaaaa
gaagccaaacaagaaggcattaaagtattagcttacgaccgtatgattaacgatgcggat
atcgatttttatatttctttcgataacgaaaaagtcggtgaactgcaggcaaaagccctg
gtcgatattgttccgcaaggtaattacttcctgatgggcggctcgccggtagataacaac
gccaagctgttccgcgccggacaaatgaaagtgttaaaaccttacgttgattccggaaaa
attaaagtcgttggtgaccaatgggttgatggctggttaccggaaaacgcattgaaaatt
atggaaaacgcgctaaccgccaataataacaaaattgatgctgtagttgcctcaaacgat
gccaccgcaggtggggcaattcaggcattaagcgcgcaaggtttatcagggaaagtagca
atctccggccaggatgcggatctcgcaggtattaaacgtattgctgccggtacgcaaact
atgacggtgtataaacctattacgttgttggcaaatactgccgcagaaattgccgttgag
ttgggcaatggtcaggaaccaaaagcagataccacactgaataatggcctgaaagatgtc
ccctcccgcctcctgacaccgatcgatgtgaataaaaacaacatcaaagatacggtaatt
aaagacggattccacaaagagagcgagctgtaa

DBGET integrated database retrieval system