KEGG   Escherichia coli K-12 DH10B: ECDH10B_3748Help
Entry
ECDH10B_3748      CDS       T00666                                 

Gene name
xylG
Definition
(GenBank) fused D-xylose transporter subunits of ABC superfamily: ATP-binding components
  KO
K10545  D-xylose transport system ATP-binding protein [EC:3.6.3.17]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd02010  ABC transporters
Module
ecd_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECDH10B_3748 (xylG)
Enzymes [BR:ecd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     ECDH10B_3748 (xylG)
Transporters [BR:ecd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    ECDH10B_3748 (xylG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_15 AAA_16 RsgA_GTPase AAA_33 AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACB04618
Position
3827801..3829342
Genome map
AA seq 513 aa AA seqDB search
MPYLLEMKNITKTFGSVKAIDNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYE
GEIIFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMT
LRCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTASLTEQETSI
LLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVG
RELTALYPNEPHTTGDEILRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGR
TETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKN
ITLAALNKFTGGISQLDDAAEQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCL
LLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHE
GKLKANLINHNLTQEQVMEAALRSEHHVEKQSV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccttatctacttgaaatgaagaacattaccaaaaccttcggcagtgtgaaggcgatt
gataacgtctgcttgcggttgaatgctggcgaaatcgtctcactttgtggggaaaatggg
tctggtaaatcaacgctgatgaaagtgctgtgtggtatttatccccatggctcctacgaa
ggcgaaattatttttgcgggagaagagattcaggcgagtcacatccgcgataccgaacgc
aaaggtatcgccatcattcatcaggaattggccctggtgaaagaattgaccgtgctggaa
aatatcttcctgggtaacgaaataacccacaatggcattatggattatgacctgatgacg
ctacgctgtcagaagctgctcgcacaggtcagtttatccatttcacctgatacccgcgtt
ggcgatttagggcttgggcaacaacaactggttgaaattgccaaggcacttaataaacag
gtgcgcttgttaattctcgatgaaccgacagcctcattaactgagcaggaaacgtcgatt
ttactggatattattcgcgatctacaacagcacggtatcgcctgtatttatatttcgcac
aaactcaacgaagtcaaagcgatttccgatacgatttgcgttattcgcgacggacagcac
attggtacgcgtgatgctgccggaatgagtgaagacgatattatcaccatgatggtcggg
cgagagttaaccgcgctttaccctaatgaaccacataccaccggagatgaaatattacgt
attgaacatctgacggcatggcatccggttaatcgtcatattaaacgagttaatgatgtc
tcgttttccctgaaacgtggcgaaatattgggtattgccggactcgttggtgccggacgt
accgagaccattcagtgcctgtttggtgtgtggcccggacaatgggaaggaaaaatttat
attgatggcaaacaggtagatattcgtaactgtcagcaagccatcgcccaggggattgcg
atggtccccgaagacagaaagcgcgacggcatcgttccggtaatggcggttggtaaaaat
attaccctcgccgcactcaataaatttaccggtggcattagccagcttgatgacgcggca
gagcaaaaatgtattctggaatcaatccagcaactcaaagttaaaacgtcgtcccccgac
cttgctattggacgtttgagcggcggcaatcagcaaaaagcgatcctcgctcgctgtctg
ttacttaacccgcgcattctcattcttgatgaacccaccaggggtatcgatattggcgcg
aaatacgagatctacaaattaattaaccaactcgtccagcagggtattgccgttattgtc
atctcttccgaattacctgaagtgctcggccttagcgatcgtgtactggtgatgcatgaa
gggaaactaaaagccaacctgataaatcataacctgactcaggagcaggtgatggaagcc
gcattgaggagcgaacatcatgtcgaaaagcaatccgtctga

DBGET integrated database retrieval system