KEGG   Escherichia coli K-12 DH10B: ECDH10B_3750Help
Entry
ECDH10B_3750      CDS       T00666                                 

Gene name
xylR
Definition
(GenBank) DNA-binding transcriptional activator, xylose-binding
  KO
K02529  
LacI family transcriptional regulator
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Transcription factors [BR:ecd03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    ECDH10B_3750 (xylR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3830579..3831757
Genome map
AA seq 392 aa AA seqDB search
MFTKRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFIEEDFRARIDKIKDWLGDGV
IADFDDKQIEQALADVDVPIVGVGGSYHLAESYPPVHYIATDNYALVESAFLHLKEKGVN
RFAFYGLPESSGKRWATEREYAFRQLVAEEKYRGVVYQGLETAPENWQHAQNRLADWLQT
LPPQTGIIAVTDARARHILQVCEHLHIPVPEKLCVIGIDNEELTRYLSRVALSSVAQGAR
QMGYQAAKLLHRLLDKEEMPLQRILVPPVRVIERRSTDYRSLTDPAVIQAMHYIRNHACK
GIKVDQVLDAVGISRSNLEKRFKEEVGETIHAMIHAEKLEKARSLLISTTLSINEISQMC
GYPSLQYFYSVFKKAYDTTPKEYRDVNSEVML
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtttactaaacgtcaccgcatcacattactgttcaatgccaataaagcctatgaccgg
caggtagtagaaggcgtaggggaatatttacaggcgtcacaatcggaatgggatattttc
attgaagaagatttccgcgcccgcattgataaaatcaaggactggttaggagatggcgtc
attgccgacttcgacgacaaacagatcgagcaagcgctggctgatgtcgacgtccccatt
gttggggttggcggctcgtatcaccttgcagaaagttacccacccgttcattacattgcc
accgataactatgcgctggttgaaagcgcatttttgcatttaaaagagaaaggcgttaac
cgctttgctttttatggtcttccggaatcaagcggcaaacgttgggccactgagcgcgaa
tatgcatttcgtcagcttgtcgccgaagaaaagtatcgcggagtggtttatcaggggtta
gaaaccgcgccagagaactggcaacacgcgcaaaatcggctggcagactggctacaaacg
ctaccaccgcaaaccgggattattgccgttactgacgcccgagcgcggcatattctgcaa
gtatgtgaacatctacatattcccgtaccggaaaaattatgcgtgattggcatcgataac
gaagaactgacccgctatctgtcgcgtgtcgccctttcttcggtcgctcagggcgcgcgg
caaatgggctatcaggcggcaaaactgttgcatcgattattagataaagaagaaatgccg
ctacagcgaattttggtcccaccagttcgcgtcattgaacggcgctcaacagattatcgc
tcgctgaccgatcccgccgttattcaggccatgcattacattcgtaatcacgcctgtaaa
gggattaaagtggatcaggtactggatgcggtcgggatctcgcgctccaatcttgagaag
cgttttaaagaagaggtgggtgaaaccatccatgccatgattcatgccgagaagctggag
aaagcgcgcagtctgctgatttcaaccaccttgtcgatcaatgagatatcgcaaatgtgc
ggttatccatcgctgcaatatttctactctgtttttaaaaaagcatatgacacgacgcca
aaagagtatcgcgatgtaaatagcgaggtcatgttgtag

DBGET integrated database retrieval system