KEGG   Escherichia coli K-12 DH10B: ECDH10B_3756Help
Entry
ECDH10B_3756      CDS       T00666                                 

Gene name
yiaK
Definition
(GenBank) 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent
  KO
K08092  
3-dehydro-L-gulonate 2-dehydrogenase [EC:1.1.1.130]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECDH10B_3756 (yiaK)
   00053 Ascorbate and aldarate metabolism
    ECDH10B_3756 (yiaK)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.130  3-dehydro-L-gulonate 2-dehydrogenase
     ECDH10B_3756 (yiaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3838333..3839331
Genome map
AA seq 332 aa AA seqDB search
MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGD
IIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRG
GSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSY
GMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLL
SDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAI
RLPGHEFTTLLAENRRNGITVDDSVWAKIQAL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgacatttgagcagttaaaagcagcctttaatcgggtcttaatttcacgcggc
gttgacagcgaaacggctgacgcctgtgcagagatgttcgcccgcaccaccgaatccggc
gtttattctcacggcgttaatcgtttccctcgtttcattcaacaactggaaaacggcgat
atcattcctgatgcccaacccaaacgtataaccagcctcggcgcaattgaacagtgggac
gcccagcgttcgatcggtaacctgacagcgaaaaagatgatggatcgcgccattgaactg
gctgccgatcacggtattggtctggtggcactacgtaatgccaaccactggatgcgcggc
ggcagctacggctggcaggcggcggaaaaaggctatattggcatttgctggaccaactcc
atcgccgtaatgccgccgtggggcgcaaaagagtgtcgcataggcactaacccgctgatc
gtcgccattccttccacgccgatcaccatggtcgatatgtcgatgtcgatgttctcttac
ggcatgttagaagttaaccgtctggcaggtcgtcagctcccggtcgatggtggctttgat
gatgagggcaatttgaccaaagaacctggcgttatcgagaagaatcgccgcattttgccg
atgggctactggaaaggttctggcatgtcgattgtgctggatatgatcgctactctcctt
tccgacggcgcatccgttgccgaagtcacccaggacaacagcgacgaatacggcatttca
caaatttttattgccattgaagtggacaagcttatcgacggtcccacccgcgatgccaag
ctgcaacgcatcatggattacgttactagtgccgagcgtgctgacgaaaatcaggccatt
cgcttacccggccatgaatttactaccctgctggccgaaaaccgccgtaacggcatcact
gttgatgacagcgtgtgggccaaaatccaggcgttatga

DBGET integrated database retrieval system