KEGG   Escherichia coli K-12 DH10B: ECDH10B_3761Help
Entry
ECDH10B_3761      CDS       T00666                                 

Gene name
lyxK
Definition
(GenBank) L-xylulose kinase
  KO
K00880  
L-xylulokinase [EC:2.7.1.53]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECDH10B_3761 (lyxK)
   00053 Ascorbate and aldarate metabolism
    ECDH10B_3761 (lyxK)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.53  L-xylulokinase
     ECDH10B_3761 (lyxK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3842684..3844180
Genome map
AA seq 498 aa AA seqDB search
MTQYWLGLDCGGSWLKAGLYDREGREAGVQRLPLCALSPQPGWAERDMAELWQCCMAVIR
ALLTHSGVSGEQIVGIGISAQGKGLFLLDKNDKPLGNAILSSDRRAMEIVRRWQEDGIPE
KLYPLTRQTLWTGHPVSLLRWLKEHEPERYAQIGCVMMTHDYLRWCLTGVKGCEESNISE
SNLYNMSLGEYDPCLTDWLGIAEINHALPPVVGSAEICGEITAQTAALTGLKAGTPVVGG
LFDVVSTALCAGIEDEFTLNAVMGTWAVTSGITRGLRDGEAHPYVYGRYVNDGEFIVHEA
SPTSSGNLEWFTAQWGEISFDEINQAVASLPKAGGDLFFLPFLYGSNAGLEMTSGFYGMQ
AIHTRAHLLQAIYEGVVFSHMTHLNRMRERFTDVHTLRVTGGPAHSDVWMQMLADVSGLR
IELPQVEETGCFGAALAARVGTGVYHNFSEAQRDLRHPVRTLLPDMTAHQLYQKKYQRYQ
HLIAALQGFHARIKEHTL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatactggctggggttagattgtggcggtagctggctgaaagccgggctgtat
gaccgcgaaggccgggaggcaggcgtgcagcgcctgccgctgtgcgcattaagcccgcag
ccaggctgggcagagcgcgatatggcagaactgtggcaatgctgcatggctgtcattcgc
gccctgcttactcattctggtgttagcggggaacaaattgtcggtatcggcatctccgca
cagggaaagggcttgtttttgctggataaaaacgacaaaccgctcgggaatgctattttg
tcctcggaccgccgggcgatggaaatcgttcgtcgctggcaggaagatggcatcccggaa
aaactctacccgctgacccgacaaaccttgtggaccgggcatccggtgtcgctgttacgc
tggctgaaagagcacgaaccagaacgctacgcgcaaattggctgcgtgatgatgacgcac
gactacctgcgctggtgtttaactggcgtcaaaggctgtgaagagagcaatatttccgag
tccaacctctacaacatgagtcttggggaatatgacccgtgcctcaccgactggctgggg
atcgctgaaatcaatcacgccctgccgcctgttgtcggatctgccgaaatctgcggggag
atcaccgctcagacagccgccctgaccggtctgaaagcgggtacgcccgttgttggcggc
ctgtttgatgtggtttccaccgcactctgcgccgggatcgaagacgaatttaccctcaat
gcggtgatggggacctgggcggtgaccagcggcataacccgcggtttacgtgacggtgaa
gcgcatccgtatgtctatggtcgctacgttaacgatggtgaatttatcgttcacgaagcc
agccctacctcttccggcaacctcgaatggtttaccgcacagtggggagaaatctcgttt
gatgagatcaatcaggccgttgccagcttgccgaaggctgggggcgatctctttttcctg
ccgttcctgtacggcagcaacgccggactcgagatgaccagtggtttctacgggatgcag
gccattcacacccgcgcgcacctgttgcaggccatctatgaaggggtggtgttcagccat
atgacccacctcaaccgaatgcgcgaacgttttactgatgttcacaccctacgcgtcact
ggcggcccggcgcactccgatgtctggatgcaaatgctggcggacgtcagcggtctgcgt
atcgagctgccgcaggtggaagaaaccggctgctttggtgcggcccttgccgcccgcgtc
ggcaccggggtttatcacaacttcagcgaagcccaacgtgacttgcgacacccggtgcgc
accctgctgccagatatgaccgcccatcagctttaccaaaaaaaatatcaacgttatcag
catctcattgccgcacttcagggctttcacgcccgcattaaggagcacacattatga

DBGET integrated database retrieval system