KEGG   Escherichia coli K-12 DH10B: ECDH10B_3763Help
Entry
ECDH10B_3763      CDS       T00666                                 

Gene name
sgbU
Definition
(GenBank) predicted L-xylulose 5-phosphate 3-epimerase
  KO
K03079  
L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECDH10B_3763 (sgbU)
   00053 Ascorbate and aldarate metabolism
    ECDH10B_3763 (sgbU)
Enzymes [BR:ecd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     ECDH10B_3763 (sgbU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3844832..3845692
Genome map
AA seq 286 aa AA seqDB search
MRNHQLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLDWSAAQRTSLVA
AMIETGVGIPSMCLSAHRRFPFGSRDEAVRERAREIMSKAIRLARDLGIRTIQLAGYDVY
YEDHDEGTRQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKWDEMLASPWFTV
YPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTGQSPGQFRDVPFGEGCVDFVGIF
KTLHKLNYRGSFLIEMWTEKAKEPVLEIIQARRWIEARMQEAGFIC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaatcatcagttagggatttatgaaaaagcgctggcgaaagatctctcctggccg
gagcggctggtgctggcaaaaagctgcggttttgattttgtcgaaatgtcggtggatgaa
accgacgaacggctctcacgtcttgactggagcgccgcacaaaggacttcgctggttgcc
gcgatgatcgaaacaggtgttgggatcccgtcgatgtgcctgtccgcacatcgtcgcttt
ccctttggtagccgtgacgaggcagtgcgcgaacgggcgcgggaaatcatgagtaaagcg
attcgcctggcgcgcgatctcggcattcgcaccatccagctggcaggttatgacgtctat
tacgaagaccacgacgaaggcacccggcaacgttttgctgaagggctggcgtgggcagtc
gaacaggcggcggcatcacaagtaatgctggcggtggagattatggataccgcgtttatg
aactccatcagcaaatggaaaaaatgggacgagatgctcgcctcaccgtggttcaccgtc
tacccggacgtcggcaacctcagcgcctggggcaatgatgttcccgccgaactgaaactg
ggcattgaccgtatcgccgcgatccacctgaaagacacccagccagtcaccgggcaaagt
cccggacagttccgcgacgtgccgtttggcgaaggctgcgtcgatttcgttggcatcttc
aaaacgctgcataaactgaactatcgcggttctttcctgattgagatgtggaccgaaaaa
gccaaagagccggtgctggagattattcaggcgcggcgttggattgaagcgcgtatgcag
gaggctggatttatatgttag

DBGET integrated database retrieval system