KEGG   Escherichia coli K-12 DH10B: ECDH10B_3764Help
Entry
ECDH10B_3764      CDS       T00666                                 

Gene name
sgbE
Definition
(GenBank) L-ribulose-5-phosphate 4-epimerase
  KO
K03077  
L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECDH10B_3764 (sgbE)
   00053 Ascorbate and aldarate metabolism
    ECDH10B_3764 (sgbE)
Enzymes [BR:ecd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     ECDH10B_3764 (sgbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3845686..3846381
Genome map
AA seq 231 aa AA seqDB search
MLEQLKADVLAANLALPAHHLVTFTWGNVSAVDETRQWMVIKPSGVEYDVMTADDMVVVE
IASGKVVEGSKKPSSDTPTHLALYRRYAEIGGIVHTHSRHATIWSQAGLDLPAWGTTHAD
YFYGAIPCTRQMTAEEINGEYEYQTGEVIIETFEERGRSPAQIPAVLVHSHGPFAWGKNA
ADAVHNAVVLEECAYMGLFSRQLAPQLPAMQNELLDKHYLRKHGANAYYGQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaactgaaagccgacgtgctggcggcgaatctggcgcttcccgctcaccat
ctggtgacgttcacctggggcaatgtcagcgcggtagacgaaacgcggcaatggatggta
atcaaaccttccggcgtcgagtacgacgtgatgaccgccgacgatatggtggtggttgag
atagccagcggtaaggtggtggaaggcagcaaaaaaccctcttccgatacaccaacgcat
ctggcgctctaccgtcgctatgccgaaattggcggtattgtgcatacccactcgcgccac
gccaccatctggtcacaggccgggctggatctccccgcctggggcaccacccacgccgat
tatttttacggtgccatcccctgcacgcgacagatgaccgcagaggagattaacggcgaa
tatgaatatcagaccggcgaagtgatcattgaaaccttcgaagaacgtggcaggagtccg
gcacaaatcccggcggtgctggtgcattctcacggcccgttcgcatggggtaaaaacgcc
gccgatgccgtgcataacgccgtagtactcgaagaatgcgcctatatgggtctattctcg
cgccagcttgcgccgcagctccctgcgatgcaaaacgaactgctggataagcactacctg
cgtaagcatggggccaatgcctattacgggcagtaa

DBGET integrated database retrieval system