KEGG   Escherichia coli K-12 DH10B: ECDH10B_3776Help
Entry
ECDH10B_3776      CDS       T00666                                 

Gene name
yibJ
Definition
(GenBank) predicted Rhs-family protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3862821..3863522
Genome map
AA seq 233 aa AA seqDB search
MQMLDRLESEILADRVSEESRRWLASCGLTVEQMKNQMDPVYTPARKIHLYHCDHRGLPL
ALISTEGATAWCAEYDEWGNLLSDENPHHLQQLIRLPGQQYDEESGLYYNRHRYYDPLLG
RYITQDPIGLKGGWNFYQYPLNPVINVDPQGLVDINLYPESDLIHSVADEINIPGVFTIG
GHGTPTSIESATRSIMTAKDLAYLIKFDGNYKDGMTVWLFSCNTGKGQNSFAS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatgctcgaccggctggaaagtgaaatcctggctgaccgggtgagtgaggaaagc
cgccgctggctggcatcgtgcggcctgaccgtggagcagatgaaaaaccagatggacccg
gtgtacacgccggcgcgaaaaatccacctgtaccactgcgaccatcgcggcctgccgctg
gcgctcatcagcacggaaggggcaacagcgtggtgcgcagaatatgatgaatggggcaac
ctgctgagtgatgagaacccgcatcatctgcagcagctcattcgcctgccgggtcagcag
tatgatgaggagtccggcctgtattacaaccgccaccgctattatgacccgctgctgggg
cggtatatcactcaggatccgattggactgaaggggggatggaatttttatcagtatccg
ttgaatccggtcataaatgtagatccgcaaggtttggttgatataaatttataccccgaa
agtgatcttatccattctgtagctgatgagattaatatcccaggcgttttcacaatcggg
gggcatggtacccccacatctattgaatccgcaacgcgcagtatcatgacagctaaagat
ctagcatatctaattaaatttgatgggaattataaagatgggatgacagtttggttattt
tcttgtaatacaggtaaaggacaaaattcatttgctagctaa

DBGET integrated database retrieval system