KEGG   Escherichia coli K-12 DH10B: ECDH10B_3777Help
Entry
ECDH10B_3777      CDS       T00666                                 

Gene name
yibG
Definition
(GenBank) conserved protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3863777..3864238
Genome map
AA seq 153 aa AA seqDB search
MKACLLLFFYFSFICQLHGADVKIKQNESMMGSTAMTYDLSEEKLMKLKYKSQHGDSEAS
FRLYQYYCFTKNNIYKQLRFLERSASQGNVTAQFNYGVFLSDTNPTLSEYYNLNRAIYWM
EFAVNNGNIDAKSKLQELKKLKRMDRRKNKENP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatgcttgttactatttttttatttctcttttatttgtcaattgcatggtgct
gatgtgaaaataaaacaaaacgaaagtatgatggggtctacagcaatgacctatgattta
agtgaagaaaagttgatgaaactgaagtataaatcacaacatggtgattcagaggcatca
tttcgactatatcaatattactgctttactaaaaataacatttacaaacaattgcgattc
ttggaaagatcagcatctcaggggaatgttacagcgcagtttaattatggggtcttttta
tcagatacaaatccaacattatcagaatattataatttgaatagagctatttattggatg
gaattcgctgtaaataacggtaatattgatgcaaagagcaaacttcaagagctcaaaaag
ctaaagcgaatggatagaaggaagaataaggagaatccgtaa

DBGET integrated database retrieval system