KEGG   Escherichia coli K-12 DH10B: ECDH10B_3778Help
Entry
ECDH10B_3778      CDS       T00666                                 

Gene name
yibH
Definition
(GenBank) predicted protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD Biotin_lipoyl_2 HlyD_D23 HlyD_3 Leu_zip Biotin_lipoyl PsbY SlyX DUF641 TolA_bind_tri BBP1_C BofA Fib_alpha
Motif
Other DBs
NCBI-ProteinID: ACB04646
Position
complement(3865843..3866979)
Genome map
AA seq 378 aa AA seqDB search
MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA
VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL
RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG
SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY
AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV
VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM
RKVLLRMTSWMHYLYLDH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggatctattgattgttttaacttacgtggcgctggcgtgggcggtctttaaaatcttc
cgcattccggtaaatcagtggacgctggcgacggcggcgctgggaggcgtgtttctggtg
agtggtttgattttgttgatgaactacaaccacccttacacttttaccgcgcaaaaggca
gtgatagcgatccctatcacgccacaggtgacgggaattgttactgaagtcactgacaag
aataatcagcttattcaaaagggcgaggtgctttttaagctcgacccggttcgttaccag
gcgcgagttgacagacttcaggctgacctgatgacggcgacgcataatataaagacgctg
cgtgcgcagctcactgaagcgcaggccaacaccacccaggtttcagcggagcgcgaccgt
ctgtttaaaaattatcaacgttacttgaaaggcagccaggcggcggtgaatccgttctcg
gaacgtgacatcgacgatgcgcggcaaaatttcctcgcgcaggatgcgctggtgaaaggc
tcggtggcggagcaggcgcagatccagagccagctcgacagtatggttaacggcgagcaa
tcgcagattgtgagcttaagagcgcaacttactgaagcaaaatataaccttgagcagact
gtcattcgcgcgccgagcaatggctacgttactcaggtactgatccgcccaggtacatac
gcagctgccttgccgctgcgtccggtgatggtcttcatccccgagcaaaaacggcaaatt
gtcgcccaatttcggcaaaactcgctgttacgtctgaaacctggcgatgatgcggaagtg
gtgtttaacgcgctacctgggcaggtgtttcacggcaaactgactagtattttacctgtc
gtgccaggcggttcttatcaggcgcagggggtattgcaatcattaacggtcgtgcccggc
acggacggtgtgctgggaaccattgaactggaccctaacgatgatatcgatgccttaccc
gacggcatctacgcccaggtggcggtttactccgaccatttcagccatgtttcggtgatg
cggaaagtgctgctaagaatgaccagctggatgcattatctttatttggatcattga

DBGET integrated database retrieval system