KEGG   Escherichia coli K-12 DH10B: ECDH10B_3779Help
Entry
ECDH10B_3779      CDS       T00666                                 

Gene name
yibI
Definition
(GenBank) predicted inner membrane protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3866982..3867344)
Genome map
AA seq 120 aa AA seqDB search
MFLNYFALGVLIFVFLVIFYGIIAIHDIPYLIAKKRNHPHADAIHTAGWVSLFTLHVIWP
FLWIWATLYQPERGWGMQSHVASQEKATDPEIAALSDRISRLEHQLAAEKKTDYSTFPEI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtttctaaactatttcgcgttgggagtgctgatcttcgtctttctggtgattttttat
ggaatcatcgcgatacatgacatcccttatctgattgccaaaaagcgcaaccatccccat
gccgacgctattcatacggcgggctgggtgagcctgtttactctgcatgttatctggccg
tttctgtggatctgggcgacgctctatcaaccggagcgtggctggggtatgcagtcacat
gttgcgtcgcaggagaaagcgactgacccggaaatcgccgcactttctgaccgaatttcc
cggctggagcatcaactcgccgccgagaaaaagactgactattccacgttcccggagatc
taa

DBGET integrated database retrieval system