KEGG   Escherichia coli K-12 DH10B: ECDH10B_3781Help
Entry
ECDH10B_3781      CDS       T00666                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate dehydrogenase, NAD(P)-binding
  KO
K00009  
mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECDH10B_3781 (mtlD)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ECDH10B_3781 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3870024..3871172
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGQVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHKNLIEGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggtacatgtggttggtgaaaccgagcaggtagataccgtt
tccggcgtcaatgctgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtt
gatttagtcactaccgccgttggcccggttgtgctggaacgtattgctccggcaatcgcc
aaagggcaggtgaaacgtaaagaacaaggtaatgaatccccgctgaacatcatcgcctgt
gaaaacatggtacgcggtaccacgcagctgaaaggccatgtgatgaacgccctgccggaa
gacgccaaagcgtgggtagaagaacacgttggctttgtcgattccgccgttgaccgcatc
gtaccgccttcggcttcggcaactaacgatccgctggaagtgacggtagaaaccttcagc
gaatggattgtcgataaaacgcagttcaaaggcgcactgccgaacatcccaggcatggag
ttaaccgacaacctgatggcatttgtcgaacgtaaactcttcaccctgaacacgggtcat
gctataaccgcgtacctcggaaaactggccggtcatcagaccattcgtgacgcgattctc
gacgagaaaatccgcgcggtggtaaaaggtgcgatggaagaaagtggtgcagtattgatc
aagcgctacggctttgacgctgacaagcatgcggcgtacatccagaaaattctcggccgt
tttgagaacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccactgcgtaaa
ctgagtgctggcgaccgtctgatcaagccactgctcggtacgctggaatatggtctgcca
cataaaaacctgattgaaggtattgccgctgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacag
atttccggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system