KEGG   Escherichia coli K-12 DH10B: ECDH10B_3782Help
Entry
ECDH10B_3782      CDS       T00666                                 

Gene name
mtlR
Definition
(GenBank) DNA-binding repressor
  KO
K02562  
mannitol operon repressor
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Transcription factors [BR:ecd03000]
 Prokaryotic Type
  Other transcription factors
   Others
    ECDH10B_3782 (mtlR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3871172..3871759
Genome map
AA seq 195 aa AA seqDB search
MVDQAQDTLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNLL
VLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREEL
NHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRSTMVLSL
TELISKISLKKAFQK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccaggcgcaggacaccctgcgcccgaataacagattgtcagatatgcaggca
acaatggaacaaacccaggcctttgaaaaccgtgtgcttgagcgtctgaatgctggcaaa
accgtgcgaagctttctgatcaccgccgtcgagctcctgaccgaggcggtaaatcttctg
gtgcttcaggtattccgcaaagacgattacgcggtgaagtatgctgtagaaccgttactc
gacggcgatggtccgctgggcgatctttctgtgcgtttaaaactcatttacgggttgggc
gtcattaaccgccaggaatacgaagatgcggaactgctgatggcattgcgtgaagagcta
aatcacgacggcaacgagtacgcctttaccgacgacgaaatccttggaccctttggtgaa
ctgcactgcgtggcggcgttaccaccgccgccacagtttgaaccagcagactccagtttg
tatgcaatgcaaattcagcgctatcaacaggctgtgcgatcaacaatggtcctttcactg
actgagctgatttccaaaatcagcttaaaaaaagcctttcaaaagtaa

DBGET integrated database retrieval system