KEGG   Escherichia coli K-12 DH10B: ECDH10B_3785Help
Entry
ECDH10B_3785      CDS       T00666                                 

Gene name
lldP
Definition
(GenBank) L-lactate permease
  KO
K00427  
L-lactate permease
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Transporters [BR:ecd02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECDH10B_3785 (lldP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3872999..3874654
Genome map
AA seq 551 aa AA seqDB search
MNLWQQNYDPAGNIWLSSLIASLPILFFFFALIKLKLKGYVAASWTVAIALAVALLFYKM
PVANALASVVYGFFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLI
VGFCFGAFLEGAAGFGAPVAITAALLVGLGFKPLYAAGLCLIVNTAPVAFGAMGIPILVA
GQVTGIDSFEIGQMVGRQLPFMTIIVLFWIMAIMDGWRGIKETWPAVVVAGGSFAIAQYL
SSNFIGPELPDIISSLVSLLCLTLFLKRWQPVRVFRFGDLGASQVDMTLAHTGYTAGQVL
RAWTPFLFLTATVTLWSIPPFKALFASGGALYEWVINIPVPYLDKLVARMPPVVSEATAY
AAVFKFDWFSATGTAILFAALLSIVWLKMKPSDAISTFGSTLKELALPIYSIGMVLAFAF
ISNYSGLSSTLALALAHTGHAFTFFSPFLGWLGVFLTGSDTSSNALFAALQATAAQQIGV
SDLLLVAANTTGGVTGKMISPQSIAIACAAVGLVGKESDLFRFTVKHSLIFTCIVGVITT
LQAYVLTWMIP
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctggcaacaaaactacgatcccgccgggaatatctggctttccagtctgata
gcatcgcttcccatcctgtttttcttctttgcgctgattaagctcaaactgaaaggatac
gtcgccgcctcgtggacggtggcaatcgcccttgccgtggctttgctgttctataaaatg
ccggtcgctaacgcgctggcctcggtggtttatggtttcttctacgggttgtggcccatc
gcgtggatcattattgcagcggtgttcgtctataagatctcggtgaaaaccgggcagttt
gacatcattcgctcgtctattctttcgataacccctgaccagcgtctgcaaatgctgatc
gtcggtttctgtttcggcgcgttccttgaaggagccgcaggctttggcgcaccggtagca
attaccgccgcattgctggtcggcctgggttttaaaccgctgtacgccgccgggctgtgc
ctgattgttaacaccgcgccagtggcatttggtgcgatgggcattccaatcctggttgcc
ggacaggtaacaggtatcgacagctttgagattggtcagatggtggggcggcagctaccg
tttatgaccattatcgtgctgttctggatcatggcgattatggacggctggcgcggtatc
aaagagacgtggcctgcggtcgtggttgcgggcggctcgtttgccatcgctcagtacctt
agctctaacttcattgggccggagctgccggacattatctcttcgctggtatcactgctc
tgcctgacgctgttcctcaaacgctggcagccagtgcgtgtattccgttttggtgatttg
ggggcgtcacaggttgatatgacgctggcccacaccggttacactgcgggtcaggtgtta
cgtgcctggacaccgttcctgttcctgacagctaccgtaacactgtggagtatcccgccg
tttaaagccctgttcgcatcgggtggcgcgctgtatgagtgggtgatcaatattccggtg
ccgtacctcgataaactggttgcccgtatgccgccagtggtcagcgaggctacagcctat
gccgccgtgtttaagtttgactggttctctgccaccggcaccgccattctgtttgctgca
ctgctctcgattgtctggctgaagatgaaaccgtctgacgctatcagcaccttcggcagc
acgctgaaagaactggctctgcccatctactccatcggtatggtgctggcattcgccttt
atttcgaactattccggactgtcatcaacactggcgctggcactggcgcacaccggtcat
gcattcaccttcttctcgccgttcctcggctggctgggggtattcctgaccgggtcggat
acctcatctaacgccctgttcgccgcgctgcaagccaccgcagcacaacaaattggcgtc
tctgatctgttgctggttgccgccaataccaccggtggcgtcaccggtaagatgatctcc
ccgcaatctatcgctatcgcctgtgcggcggtaggcctggtgggcaaagagtctgatttg
ttccgctttactgtcaaacacagcctgatcttcacctgtatagtgggcgtgatcaccacg
cttcaggcttatgtcttaacgtggatgattccttaa

DBGET integrated database retrieval system