KEGG   Escherichia coli K-12 DH10B: ECDH10B_3788Help
Entry
ECDH10B_3788      CDS       T00666                                 

Gene name
yibK
Definition
(GenBank) predicted rRNA methylase
  KO
K03216  
tRNA (cytidine/uridine-2'-O-)-methyltransferase [EC:2.1.1.207]
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Enzymes [BR:ecd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.207  tRNA (cytidine34-2'-O)-methyltransferase
     ECDH10B_3788 (yibK)
Transfer RNA biogenesis [BR:ecd03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    ECDH10B_3788 (yibK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3876815..3877288
Genome map
AA seq 157 aa AA seqDB search
MLNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRH
HDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKI
RIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVLRD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatcgtactttacgaaccagaaattccgccaaatactggcaacatcatccgt
ctttgcgctaataccggctttcgtctgcatatcatcgaaccgatgggatttgcctgggac
gataagcgcctgcgccgcgcggggctggactatcacgagtttaccgccgttacgcgtcat
catgactatcgcgcgttcctcgaagcagaaaatccccagcgcctgttcgccctcaccacg
aaaggtacacctgctcacagcgccgtaagctatcaggatggcgattatctgatgttcggc
ccggaaacacgcggcctgccagcgagcattcttgatgccctgcccgctgaacaaaaaatt
cgcattccgatggtgccggacagccgcagcatgaatctgtccaatgcggtgtcggtagtg
gtgtatgaagcctggcggcagttggggtatccgggagcggtattgagagattag

DBGET integrated database retrieval system