KEGG   Escherichia coli K-12 DH10B: ECDH10B_3797Help
Entry
ECDH10B_3797      CDS       T00666                                 

Gene name
yibD
Definition
(GenBank) predicted glycosyl transferase
  KO
K19354  
heptose III glucuronosyltransferase [EC:2.4.1.-]
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Enzymes [BR:ecd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     ECDH10B_3797 (yibD)
Glycosyltransferases [BR:ecd01003]
 Polysaccharide
  Bacterial polysaccharide
   ECDH10B_3797 (yibD)
Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
 Core region
  ECDH10B_3797 (yibD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3884647..3885681)
Genome map
AA seq 344 aa AA seqDB search
MMNSTNKLSVIIPLYNAGDDFRTCMESLITQTWTALEIIIINDGSTDNSVEIAKYYAENY
PHVRLLHQANAGASVARNRGIEVATGKYVAFVDADDEVYPTMYETLMTMALEDDLDVAQC
NADWCFRETGETWQSIPTDRLRSTGVLTGPDWLRMGLSSRRWTHVVWMGVYRRDVIVKNN
IKFIAGLHHQDIVWTTEFMFNALRARYTEQSLYKYYLHNTSVSRLHRQGNKNLNYQRHYI
KITRLLEKLNRNYADKIMIYPEFHQQITYEALRVCHAVRKEPDILTRQRMIAEIFTSGMY
KRLITNVRSVKVGYQALLWSFRLWQWRDKTRSHHRITRSAFNLR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagcaccaataaacttagtgttattattccgttatataatgcgggcgatgat
ttccgcacttgtatggaatctttaattacgcaaacctggactgctctggaaatcattatt
attaacgatggttcaacggataattctgttgaaatagcaaagtattacgcagaaaactat
ccgcacgttcgtttgttgcatcaggcgaatgctggcgcatcggtggcgcgtaatcgtggg
attgaagtggcaacgggcaaatatgtcgcttttgtcgatgctgacgatgaagtctatccc
accatgtacgaaacgctgatgaccatggcgttagaggacgacctcgacgtggcgcagtgc
aacgctgactggtgttttcgtgaaacgggagaaacctggcaatccatccccaccgatcgc
cttcgctcaaccggcgtattaaccggcccggactggctgcggatggggctttcttcgcgc
cgttggactcacgttgtctggatgggggtttatcgccgtgatgttattgttaaaaataac
attaaatttattgccggattacatcatcaggatattgtctggacaacagaattcatgttt
aacgcgctgcgtgcgcgatataccgagcaatcattatataaatattatctgcataatacg
tcagtgagtcggttgcatagacaagggaataaaaaccttaattatcaacgtcactatatt
aagattacccgcctgctggagaaattaaatcgaaattatgccgacaaaattatgatttat
ccggaatttcatcagcaaataacttacgaggcattgcgtgtttgccatgcggtgcgcaaa
gagccggatattcttacccgccaacggatgattgccgagatatttacttccggtatgtat
aagcgcctgattaccaatgtgcgcagcgtgaaggtcggttaccaggcgttactgtggtct
ttccgcttatggcaatggcgcgacaaaacgcggtcgcaccatcgcattacgcgtagcgcc
tttaatttgcgctag

DBGET integrated database retrieval system