KEGG   Escherichia coli K-12 DH10B: ECDH10B_3806Help
Entry
ECDH10B_3806      CDS       T00666                                 

Gene name
rfaZ
Definition
(GenBank) lipopolysaccharide core biosynthesis protein
  KO
K12981  
KDO transferase III [EC:2.4.99.-]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECDH10B_3806 (rfaZ)
Enzymes [BR:ecd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     ECDH10B_3806 (rfaZ)
Glycosyltransferases [BR:ecd01003]
 Polysaccharide
  Bacterial polysaccharide
   ECDH10B_3806 (rfaZ)
Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
 Core region
  ECDH10B_3806 (rfaZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3894945..3895796)
Genome map
AA seq 283 aa AA seqDB search
MKNIRYIDKKDVENLIENKISDDVIIFLSGPTSQKTPLSVLRTKDIIAVNGSAQYLLSNN
IVPFIYVLTDVRFLHQRRDDFYKFSQRSRYTIVNVDVYEHASKEDKLYILQNCLVLRSFY
RREKGGFIKKIKFNILRQIHKELLISVPLSKKGRLVGFCKDISLGYCSCHTIAFAAIQIA
YSLKYARIICSGLDLTGSCSRFYDENKNPMPSELSRDLFKILPFFRFMHDNVKDINIYNL
SDDTAISYDVIPFIKLQDISAEESKDMTRKKMQYRTSTDSYAN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatattagatacattgacaaaaaagatgttgaaaacctgattgaaaataaaata
tctgatgatgttattatttttctttcgggccctacatcgcaaaaaacacctttgtcagta
ttacgaacaaaggatattattgctgtcaatggttctgcgcaatatctgttaagtaataat
atcgttccttttatatatgtacttacagatgtccgatttttacatcagcgtcgtgatgat
ttttataaatttagccagagaagtcgttataccatagtaaacgttgacgtttatgaacac
gcttccaaagaagataaactttatatcctccagaactgcctcgtattacggtccttttac
cgtcgggaaaaaggtggttttataaagaagattaaatttaatattttgagacagattcac
aaagaactgctgatctctgtaccgttgtctaaaaaaggtcgtctggttggattttgcaag
gacattagtcttggttattgctcatgccatactattgcctttgctgcaattcaaatcgca
tattcacttaagtatgcgcggattatttgttctggtcttgatttaacgggtagctgttct
cgtttctatgatgagaataaaaatcccatgccctcggaattaagtagggatttattcaaa
atattgccattttttcgttttatgcatgataatgtaaaagatattaatatttataattta
tcagatgatacagctatttcttacgatgtaattccatttattaaacttcaagacatcagt
gcagaagaatcaaaagatatgacaagaaaaaaaatgcaatatagaacttcaaccgattct
tatgctaattaa

DBGET integrated database retrieval system