KEGG   Escherichia coli K-12 DH10B: ECDH10B_3809Help
Entry
ECDH10B_3809      CDS       T00666                                 

Gene name
rfaI
Definition
(GenBank) UDP-D-galactose:(glucosyl)lipopolysaccharide-alpha-1,3-D-galactosyltransferase
  KO
K03275  
UDP-glucose:(glucosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECDH10B_3809 (rfaI)
Enzymes [BR:ecd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     ECDH10B_3809 (rfaI)
Glycosyltransferases [BR:ecd01003]
 Polysaccharide
  Bacterial polysaccharide
   ECDH10B_3809 (rfaI)
Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
 Core region
  ECDH10B_3809 (rfaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3897639..3898658)
Genome map
AA seq 339 aa AA seqDB search
MQQVFFQETEFLNSVIDYDHKVETENLCLDIAYGTDKNFLFGCGISIASILKYNEGSRLC
FHIFTDYFGDDDRKYFDALALQYKTRIKIYLINGDRLRSLPSTKNWTHAIYFRFVIADYF
INKAPKVLYLDADIICQGTIEPLINFSFPDDKVAMVVTEGQADWWEKRAHSLGVAGIAKG
YFNSGFLLINTAQWAAQQVSARAIAMLNEPEIIKKITHPDQDVLNMLLADKLIFADIKYN
TQFSLNYQLKESFINPVTNDTIFIHYIGPTKPWHDWAWDYPVSQAFMEAKNASPWKNTAL
LKPNNSNQLRYSAKHMLKKHRYLKGFSNYLFYFIEKIKH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggtgtttttccaggaaactgagtttcttaattcagttattgattatgatcat
aaagtagaaacagaaaatctttgtctggacatcgcttatggaactgacaaaaactttcta
tttggttgcggaatttcgattgcttcaatattaaaatataatgaaggaagtcgattgtgt
ttccatatttttactgattattttggtgatgatgatcgtaagtattttgatgccctggcg
ttgcagtataaaaccagaattaaaatatatctgattaatggtgatcgactgcgctcattg
cctagcactaagaattggactcatgcaatatattttcgttttgttattgcagattacttt
attaataaggcgcctaaagtcctttatctggatgcagatatcatttgtcaggggactatt
gagccactaattaatttctcatttcctgacgataaagtcgcaatggttgttacagaaggg
caagctgactggtgggaaaaacgcgcccattcgttaggtgttgcgggaattgctaaaggt
tactttaactccggttttttattgattaatactgcccaatgggcggctcagcaggtttct
gcacgagctattgcaatgctaaatgagccagaaataatcaaaaaaataacacatcctgat
caggatgtgttaaatatgttgctggcggataaacttattttcgctgatattaaatataac
acccagttcagcttaaattatcaactcaaagaaagctttataaacccagtaaccaacgat
actatttttatccattatatcgggccaaccaagccctggcatgattgggcctgggattat
cctgtatcacaagcctttatggaggcaaaaaatgcttcgccatggaagaatacggcgttg
ctgaaaccgaacaatagcaatcaattaagatatagcgcaaaacatatgcttaaaaagcat
agatatctaaaaggatttagcaactatcttttttattttattgaaaagataaagcattaa

DBGET integrated database retrieval system