KEGG   Escherichia coli K-12 DH10B: ECDH10B_3812Help
Entry
ECDH10B_3812      CDS       T00666                                 

Gene name
rfaP
Definition
(GenBank) kinase that phosphorylates core heptose of lipopolysaccharide
  KO
K02848  
heptose I phosphotransferase [EC:2.7.1.-]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECDH10B_3812 (rfaP)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     ECDH10B_3812 (rfaP)
Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
 Core region
  ECDH10B_3812 (rfaP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3900753..3901550)
Genome map
AA seq 265 aa AA seqDB search
MVELKEPLATLWRGKDAFAEVKKLNGEVFRELETRRTLRFELSGKSYFLKWHKGTTLKEI
IKNLLSLRMPVLGADREWHAIHRLSDVGVDTMKGIGFGEKGLNPLTRASFIITEDLTPTI
SLEDYCADWAVNPPDIRVKRMLIARVATMVRKMHTAGINHRDCYICHFLLHLPFTGREDE
LKISVIDLHRAQIRAKVPRRWRDKDLIGLYFSSMNIGLTQRDIWRFMKVYFGMPLRKILS
LEQNLLNMASVKAERIKERTQRKGL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagagccgcttgccacactttggcgtggtaaagatgcttttgcagag
gtcaaaaaactgaacggcgaggtctttcgtgaactggagactcgtcgtacattacgcttt
gaactgtccgggaaaagctattttcttaaatggcacaaggggacgacattaaaagagatt
ataaaaaatctactctcattgcggatgcccgttttgggcgcagacagagagtggcacgct
attcatcgcctgagtgatgttggcgttgatacaatgaagggcattgggtttggcgaaaaa
gggttaaatccattaactcgcgcatcatttattattaccgaagatctcactcccacaatt
agccttgaagattattgtgccgattgggcagtcaacccgcctgatatacgtgttaagcgt
atgctgatcgcacgtgtagcaactatggtgcgtaaaatgcatactgcagggataaatcac
cgcgactgttacatttgccactttttgcttcatttgccatttactggccgggaagatgaa
ttaaaaatttcagttatcgatctgcatcgggcacagatacgtgcaaaagtaccgcgccgc
tggcgcgataaagacctgattggtttatatttctcatcaatgaatattggcctgacgcaa
agagatatctggcgatttatgaaggtttattttgggatgcctttacgcaaaatattgtct
cttgaacagaatttattgaacatggcaagcgttaaggccgagcgtattaaagagcgaaca
caacgcaaaggattataa

DBGET integrated database retrieval system