KEGG   Escherichia coli K-12 DH10B: ECDH10B_3817Help
Entry
ECDH10B_3817      CDS       T00666                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ecd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3905943..3906752)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLL
LELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKEL
EGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccgcggcatagaaccgcatctcgttggt
gcaaccattcttcatgcagtggtgcgcaacggacgcttgcgctggccggtttcagaagag
atctaccgtttaagcgaccaaccagtgcttagcgtgcagcggcgggctaaatatctgctg
ctggagctgcctgagggctggattatcattcatttagggatgtctggcagcctgcgcatc
cttccagaagaacttccccctgaaaagcatgaccatgtggatttggtgatgagcaacggc
aaagtgctgcgctacaccgatccgcgccgctttggtgcctggctgtggaccaaagagctg
gaagggcataatgtgctgacccatcttggaccggagccgcttagcgacgatttcaatggt
gagtatctgcatcagaagtgcgcgaagaaaaaaacggcgattaaaccgtggctgatggat
aacaagctggtggtaggggtagggaatatctatgccagcgaatcactgtttgcggcgggg
atccatccggatcggctggcgtcatcactgtcgctggcagagtgtgaattgttagctcgg
gtgattaaagcggtgttgctgcgttcgattgagcagggtggtacaacgctgaaagatttt
ctgcaaagtgatggtaaaccgggctatttcgctcaggaattgcaggtttacgggcgaaaa
ggtgagccgtgtcgggtgtgcggtacgccgattgtggcgactaaacatgcgcagcgggca
acgttttattgtcggcagtgccagaagtaa

DBGET integrated database retrieval system