KEGG   Escherichia coli K-12 DH10B: ECDH10B_3830Help
Entry
ECDH10B_3830      CDS       T00666                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00230  Purine metabolism
ecd01100  Metabolic pathways
Module
ecd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECDH10B_3830 (gmk)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ECDH10B_3830 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 AAA_16 AAA_22 ABC_tran AAA_33 AAA_18 AAA_29 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ACB04697
Structure
PDB: 

Jmol
Position
3917029..3917652
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHD
EFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacacccaggtttctgtttcacacacc
acacgccaaccgcgtcctggtgaagtccacggtgaacattatttctttgttaatcatgat
gaatttaaagaaatgattagcagagatgcgttcctcgaacacgcagaagtttttggtaat
tactatggcacttcgcgtgaggccattgagcaagtactggcgaccggtgtcgatgttttt
ctcgatatcgactggcagggcgcgcagcaaattcgccagaagatgccgcacgcgcggagt
atctttattttaccgccgtccaaaattgaactggaccgccgtctacgcggtcgcggtcag
gacagcgaagaggtcattgcaaagcgtatggcgcaagctgttgcagaaatgagccattac
gccgaatatgattatctgattgtgaatgatgacttcgataccgcgttgaccgatttgaag
accattattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system