KEGG   Escherichia coli K-12 DH10B: ECDH10B_3842Help
Entry
ECDH10B_3842      CDS       T00666                                 

Gene name
yicL
Definition
(GenBank) predicted inner membrane protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3933855..3934778
Genome map
AA seq 307 aa AA seqDB search
MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEQSQMSSQFLTMTRLIFAGLILLTLSFVHGD
KIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATVLQFLSPTIIVAWFSLV
RKSRPGILVFCAILTSLVGTFLLVTHGNPTSLSISPAALFWGIASAFAAAFYTTYPSTLI
ARYGTLPVVGWSMLIGGLILLPFYARQGTNFVVNGSLILAFFYLVVIGTSLTFSLYLKGA
QLIGGPKASILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVILISMDSRRRARKI
NRPARHK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggttccaccagaaaggggatgctgaacgttctgattgccgccgtgttgtggggaagt
tcaggggtctgcgcgcaatacatcatggagcaaagccagatgtcgtcgcagtttttgact
atgacgcgtttgatattcgccggtttgattctactgacgctgtcatttgttcatggcgat
aaaatcttttctattattaacaatcataaagatgccattagcctgctgattttttccgtg
gttggcgcgctaactgtacagctcacttttttgctaaccatcgaaaaatcgaacgcagcc
acggcaacggtgctgcaattcctctcaccgacgattatcgtcgcctggttctcactggtg
cgtaaatcgcgcccgggcattctggttttctgcgctattttgacatcgctggtcgggact
tttttattggtgacacacggtaatccgacgtcattatcgatctctcctgccgcgttgttc
tggggcattgcctcggcatttgctgctgcattctataccacctatccctcaacgctaatt
gcccgctatggcacgttaccagtcgtcggctggagtatgctgattggcggtctgattctg
ttgcctttttatgccagacaaggaacaaactttgtcgttaacggcagtttgattctggcg
tttttttatttggtggtcattggtacgtccctgacatttagtctgtacctgaaaggagca
caattaattggcggtccaaaagccagcattttgagctgtgcagaaccattaagtagcgcg
ctactctctttgctgttgctggggatcacgttcacattaccggactggctgggaacgctg
ctgattctgtcatcggtgattttgatttcaatggattcccgtcgccgcgccagaaaaata
aatcgtccggcgcggcataagtga

DBGET integrated database retrieval system