KEGG   Escherichia coli K-12 DH10B: ECDH10B_3847Help
Entry
ECDH10B_3847      CDS       T00666                                 

Gene name
yicO
Definition
(GenBank) predicted xanthine/uracil permase
  KO
K06901  
putative MFS transporter, AGZA family, xanthine/uracil permease
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Transporters [BR:ecd02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Purine transporter (AzgA) family [TC:2.A.1.40]
    ECDH10B_3847 (yicO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3938062..3939396)
Genome map
AA seq 444 aa AA seqDB search
MNNDNTDYVSNESGTLSRLFKLPQHGTTVRTELIAGMTTFLTMVYIVFVNPQILGAAQMD
PKVVFVTTCLIAGIGSIAMGIFANLPVALAPAMGLNAFFAFVVVGAMGISWQTGMGAIFW
GAVGLFLLTLFRIRYWMISNIPLSLRIGITSGIGLFIALMGLKNTGVIVANKDTLVMIGD
LSSHGVLLGILGFFIITVLSSRHFHAAVLVSIVVTSCCGLFFGDVHFSGVYSIPPDISGV
IGEVDLSGALTLELAGIIFSFMLINLFDSSGTLIGVTDKAGLIDGNGKFPNMNKALYVDS
VSSVAGAFIGTSSVTAYIESTSGVAVGGRTGLTAVVVGVMFLLVMFFSPLVAIVPPYATA
GALIFVGVLMTSSLARVNWDDFTESVPAFITTVMMPFTFSITEGIALGFMSYCIMKVCTG
RWRDLNLCVVVVAALFALKIILVD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgacaataccgattacgtgagtaatgaatcagggacgctttcgcgattattt
aaactacctcagcatgggaccaccgtccgcacagaattgattgcggggatgaccactttt
ttaaccatggtgtacatcgtttttgtgaacccgcaaatcctcggcgcggcacaaatggac
ccgaaagtggtgtttgttaccacctgtttgattgccggtatcggcagtattgcgatgggg
atatttgctaacttacccgtggcgctggctccggcaatggggctgaacgccttctttgcc
ttcgtggtcgtgggggcgatgggcatctcctggcagaccgggatgggcgcaatattctgg
ggcgcagttggactatttttgctcacgctgtttcgtatccggtactggatgatctccaac
attcccttaagtttacgtattggtatcaccagcggaattggattatttatcgccttaatg
ggattaaaaaatactggcgttattgtcgccaataaagacacgctggtgatgattggcgat
ttaagttctcacggcgtgttgttaggtattttagggttttttattataaccgtgttgtca
tcacgtcattttcatgccgcggtgctggtttctattgtggtgacgtcttgctgtggatta
tttttcggtgatgttcattttagcggcgtctattccattccgcctgatattagcggcgtc
attggtgaagtagatttgagcggcgcgttaacacttgaactcgccggtatcattttctcc
tttatgctgatcaacctatttgattcatcaggaacattaattggtgtaactgataaagcg
ggcttaatagatggtaacggtaaattccccaatatgaataaggcgctgtatgttgatagc
gtcagttcggtggcgggtgcgtttatcggcacctcgtctgttactgcctatattgaaagt
acttctggtgtggcagtcggtggccgcacggggctgactgcggttgtggttggcgttatg
ttcctgttggttatgttcttctcaccgctggtggcgatagttcctccttacgcaaccgcc
ggagcgttaatctttgttggcgtgctgatgacttcgagcctggcgcgcgttaactgggat
gattttaccgaatcggtgcctgcgtttattaccacggtgatgatgccctttactttctcg
atcaccgaagggattgcactcggctttatgtcgtactgcatcatgaaagtatgcaccggg
cgctggcgcgatctgaacctgtgtgtggtggtggtcgcagctctgtttgcactgaagatt
attctggtggattag

DBGET integrated database retrieval system