KEGG   Escherichia coli K-12 DH10B: ECDH10B_3848Help
Entry
ECDH10B_3848      CDS       T00666                                 

Gene name
ade
Definition
(GenBank) cryptic adenine deaminase
  KO
K01486  
adenine deaminase [EC:3.5.4.2]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECDH10B_3848 (ade)
Enzymes [BR:ecd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     ECDH10B_3848 (ade)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3939571..3941337
Genome map
AA seq 588 aa AA seqDB search
MNNSINHKFHHISRAEYQELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIA
GVGAEYTDAPALQRIDARGATAVPGFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPH
EIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVPALEGCDVNGASFTLEQMLAWRDHPQV
TGLAEMMDYPGVISGQNALLDKLDAFRHLTLDGHCPGLGGKELNAYITAGIENCHESYQL
EEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDAL
IRRLIEQHNVPLHVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVK
GEPIDAQTLQAEESARLAQSAPPYGNTIARQPVSASDFALQFTPGKRYRVIDVIHNELIT
HSHSSVYSENGFDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVV
IGRSAEEMALAVNQVIQDGGGLCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAA
ARECGPLPDEPFIQMAFLSLPVIPALKLTSQGLFDGEKFAFTTLEVTE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaataattctattaaccataaatttcatcacattagccgggctgaataccaggaattg
ttagccgtttcccgtggcgacgctgttgccgattatattattgataatgtctctattctc
gacctgatcaatggcggagaaatttccggcccaattgtgattaaaggacgttacattgcc
ggtgttggcgcagaatacactgatgctccggctttgcagcggattgatgctcgcggcgca
acggcggtgccagggtttattgatgctcacctgcatattgaatccagcatgatgacgccg
gtcacttttgaaaccgctaccctgccgcgcggcctgacgaccgttatttgcgaccctcat
gaaatcgtcaacgtgatgggcgaagccggattcgcctggtttgcccgctgtgccgaacag
gcaaggcaaaaccagtacttacaggtcagctcttgcgtacccgccctggaaggctgcgat
gttaacggtgccagttttacccttgaacagatgctcgcctggcgggaccatccgcaggtt
accggccttgcagaaatgatggactaccctggcgtaattagcgggcagaatgcgctgctc
gataaactggatgcatttcgccacctgacgctggacggtcactgcccgggtttgggtggt
aaagaacttaacgcctatattactgcgggtattgaaaactgccacgaaagttatcagctg
gaagaaggacgccggaaattacaactcggcatgtcgttgatgatccgcgaagggtccgct
gcccgcaatctcaacgcgctggcaccgttgatcaacgaatttaacagcccgcaatgcatg
ctctgtaccgatgaccgtaacccgtgggagatcgcccatgaaggacacatcgatgcctta
attcgccgcctgatcgaacaacacaatgtgccgctgcatgtggcatatcgcgtcgccagc
tggtcgacggcgcgccactttggtctgaatcacctcggcttactggcacccggcaagcag
gccgatatcgtcctgttgagcgatgcgcgtaaggtcacggtgcagcaggtactggtgaaa
ggcgagccgattgatgcgcaaaccttacaggcggaagagtcggcgagactggcacaatcc
gctccgccatatggcaacaccattgcccgccagccagtttccgccagcgactttgccctg
caatttacgcccggaaaacgctatcgggtcattgacgtcatccataacgaattgattacg
cactcccactccagcgtctacagcgaaaatggttttgatcgcgatgatgtgagctttatt
gccgtacttgagcgttacgggcaacggctggctccggcttgtggtttgcttggcggcttt
ggactgaatgaaggtgcgctggctgcgacggtcagccatgacagccataatattgtggtg
atcggtcgcagtgccgaagagatggcgctggcggtcaatcaggtgattcaggatggcggc
gggctgtgcgtggtacgtaacggccaggtacaaagtcatctgccgttacccattgccggg
ctgatgagcaccgacacggcgcagtcgctggcggaacaaattgacgccttgaaagccgcc
gcccgtgaatgcggtccgttacccgatgagccgtttattcagatggcgtttctttctctg
ccagtgatccccgcgctaaaactaaccagtcaggggctatttgatggcgagaagtttgcc
ttcactacgctggaagtcacggaataa

DBGET integrated database retrieval system