KEGG   Escherichia coli K-12 DH10B: ECDH10B_3850Help
Entry
ECDH10B_3850      CDS       T00666                                 

Gene name
uhpC
Definition
(GenBank) membrane protein regulates uhpT expression
  KO
K07783  
MFS transporter, OPA family, sugar phosphate sensor protein UhpC
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECDH10B_3850 (uhpC)
Transporters [BR:ecd02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    ECDH10B_3850 (uhpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3942912..3944231)
Genome map
AA seq 439 aa AA seqDB search
MLPFLKAPADAPLMTDKYEIDARYRYWRRHILLTIWLGYALFYFTRKSFNAAVPEILANG
VLSRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMGIGLIATGIINILFGFSTSLWA
FAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGALIPIVMAAAALH
YGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGEWRHDALEIAQQQEGAGLTRKE
ILTKYVLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETLGVDLVTANTAVTMFELGGF
IGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMPFASYVMQATCFFTIGFFVFG
PQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLAGWPLAKVLDTWHWSGFFVVISIAA
GISALLLLPFLNAQTPREA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgtttctgaaagcgcctgccgatgcgccattaatgactgataaatatgaaatt
gatgcccgctatcgctactggcgtcggcatattctgctgaccatctggctgggttacgcg
ctgttttacttcacgcggaaaagttttaacgccgccgtaccagaaatccttgctaacggc
gtgctcagccgtagcgatatcggcctgttagcgaccctgttttacattacctatggcgtg
tcgaagtttgtctccggcattgtcagcgatcgctcaaatgcccgttattttatggggata
gggcttatcgccacgggcattatcaacattctgtttggcttctcgacgtcgctatgggcg
tttgccgtgctctgggtgctgaacgcctttttccagggctggggttcaccggtgtgtgcg
cgtctgttaacggcctggtattcacgtaccgagcgcggcggttggtgggcattatggaac
acggcgcataacgtcggcggcgcactcattcccattgtgatggcagcggctgcgctgcat
tacggctggcgtgccgggatgatgattgctggttgtatggcgatagtcgtggggattttt
ctctgctggcggctacgcgatcgcccgcaggcgttaggtttaccggcggtcggtgaatgg
cgacacgacgcgctggaaattgctcaacaacaagaaggggcagggttgacgcgtaaagag
atcctcaccaaatatgtgttgctgaatccgtatatctggctgctttcgttttgctatgtg
ctggtctatgtggtccgggcggcgatcaacgactggggcaatttgtatatgtccgagaca
ctgggcgtcgatctggtcacggcgaatacggcagtgacgatgtttgaactgggcggattt
atcggtgcgctggtagccggttggggctcggacaaattgtttaacggcaaccgagggccg
atgaatttgattttcgccgccggaattttgctttcagtcggctccctgtggctgatgcca
tttgccagctacgtgatgcaggcaacctgcttcttcaccattggtttttttgtctttggc
ccacagatgttaatcggtatggcggcggcagagtgttcccacaaagaggcggcaggggcg
gcgacggggtttgtcggcttgtttgcttatctgggggcgtcgcttgctggttggccgctg
gcgaaagtactcgatacctggcactggagcggattttttgtggttatctctatcgccgcc
gggatttccgcactgctgttactgccctttttgaacgcccagacaccgcgcgaagcgtga

DBGET integrated database retrieval system