KEGG   Escherichia coli K-12 DH10B: ECDH10B_3851Help
Entry
ECDH10B_3851      CDS       T00666                                 

Gene name
uhpB
Definition
(GenBank) sensory histidine kinase in two-component regulatory sytem with UhpA
  KO
K07675  
two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Two-component system
Module
UhpB-UhpA (hexose phosphates uptake) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECDH10B_3851 (uhpB)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECDH10B_3851 (uhpB)
Protein kinases [BR:ecd01001]
 Histidine protein kinases
  NarL family
   ECDH10B_3851 (uhpB)
Two-component system [BR:ecd02022]
 NarL family
  UhpB-UhpA [MD:M00473]
   ECDH10B_3851 (uhpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3944241..3945743)
Genome map
AA seq 500 aa AA seqDB search
MKTLFSRLITVIACFFIFSAAWFCLWSISLHLVERPDMAVLLFPFGLRLGLMLQCPRGYW
PVLLGAEWLLIYWLTQAVGLTHFPLLMIGSLLTLLPVALISRYRHQRDWRTLLLQGAALT
AAALLQSLPWLWHGKESWNALLLTLTGGLTLAPICLVFWHYLANNTWLPLGPSLVSQPIN
WRGRHLVWYLLLFVISLWLQLGLPDELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI
ALIASQTWRDHPVDLLLSLLVQSLTGLLLGAGIQRLRELNQSLQKELARNQHLAERLLET
EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNASVKQSGQLIEQLSLGVYDAVRR
LLGRLRPRQLDDLTLEQAIRSLMREMELEGRGIVSHLEWRIDESALSENQRVTLFRVCQE
GLNNIVKHADASAVTLQGWQQDERLMLVIEDDGSGLPPGSGQQGFGLTGMRERVTALGGT
LHISCLHGTRVSVSLPQRYV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttgttctcccgcttaattaccgttattgcctgcttttttatcttctctgcc
gcatggttttgcctgtggagtatcagcctgcatctggttgagcgccctgatatggcggtg
ctgttatttccgtttggtctgcgtctggggctaatgctgcaatgcccgcgcggatactgg
cccgtattgctgggcgcggagtggctgctgatttactggctaacgcaggcggtcggttta
acccattttccgttattgatgatcggtagtttactgacgttactgcccgtagcgctgatc
tcgcgctatcgccatcagcgtgactggcgcaccttgctgttacagggggcggcgttaacg
gcggcggcgttgttgcagtcgctgccctggctttggcacggcaaagagtcgtggaatgcg
ctgttgctgactttaactggcggcctgacgctggccccgatatgtctggtgttctggcac
tatctcgccaataacacctggctgccgctcggtccgtcactggtttctcagccaatcaac
tggcgcgggcgacatctggtctggtacttgctgctgtttgttatcagtctctggctccag
ttgggattgccggacgaactgtcgcgctttacgccattctgtctggcgctgccgattatc
gcgctggcctggcactatggttggcaaggggcgctgattgcgacgttgatgaacgccatc
gcgctgatcgccagtcaaacctggcgcgatcatccggtggatttattgctctcgctgctg
gtgcaaagtctgacagggttgttgcttggcgctggcatccagcggttgcgtgaacttaac
cagtcgctgcaaaaggaactggcgcgcaatcagcatctggctgaacggttgctggaaacc
gaagagagcgtgcgccgtgatgtggcgcgtgagctgcatgatgatatcggtcagaccatc
actgctattcgtactcaggcgggcattgttcagcggctggcggcagataacgccagcgtg
aagcagagcgggcagctcatcgaacaactatcgctgggcgtttacgacgcggtgcgccgt
ttgttgggtcggttacgtccgcgccagttggatgatctcaccctggagcaggccatccgc
tcactgatgcgggaaatggagctggaagggcgcggtattgtcagccatctcgaatggcga
atcgatgaatcagcgttaagcgaaaaccagcgcgtgacgctgtttcgtgtctgccaggaa
gggctgaacaacattgtgaaacatgctgatgccagcgcggtcaccctgcaaggctggcag
caggatgaacggttgatgctggttattgaagacgatggcagcggtttgccgccgggttcc
gggcaacaaggttttggcctcaccggaatgcgcgagcgcgtaacggcgctgggtggcaca
ttacacatttcctgtctgcacggcacgcgtgtcagcgtttctctacctcaacgctatgtc
taa

DBGET integrated database retrieval system