KEGG   Escherichia coli K-12 DH10B: ECDH10B_3857Help
Entry
ECDH10B_3857      CDS       T00666                                 

Gene name
yidF
Definition
(GenBank) predicted DNA-binding transcriptional regulator
  KO
K06871  
uncharacterized protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
complement(3950721..3951218)
Genome map
AA seq 165 aa AA seqDB search
MTGSQVIDAEEDRHKLVVEYKDALQPADFYHNFKQRGIRSVQLIPYLEFDDRGDLTAASV
TAELWGKFLIALFECWVRADISRISIELFDATLQKWCGSENPQPRCDCQACDWHRLCPHA
RQETPDSVLCAGYQAFYSYSAPHMRVMRDLIKQHRSPMELMTMLR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaagtcaggtcattgatgctgaagaggacaggcataaactggttgtagagtac
aaggatgctctgcaacctgccgatttttatcacaatttcaaacagcggggcatccgctcc
gtacagctcattccctatcttgaatttgatgaccggggcgatctgacggccgcttcggtg
acagcagagctgtgggggaaatttttaattgccctgttcgagtgttgggtgcgggcagat
atcagtcgtatctcgattgagctttttgacgccaccttacaaaaatggtgtggcagcgaa
aacccgcaaccgcgctgtgactgccaggcgtgcgactggcatcgcctgtgcccgcacgct
cggcaggagacgccagacagcgtgctttgtgcgggctatcaggcgttttattcttactcc
gcaccgcatatgcgggtgatgcgtgatctgataaagcagcatcgttctcccatggagctg
atgacgatgctgcggtga

DBGET integrated database retrieval system