KEGG   Escherichia coli K-12 DH10B: ECDH10B_4108Help
Entry
ECDH10B_4108      CDS       T00666                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00010  Glycolysis / Gluconeogenesis
ecd00051  Fructose and mannose metabolism
ecd00562  Inositol phosphate metabolism
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
ecd01120  Microbial metabolism in diverse environments
ecd01130  Biosynthesis of antibiotics
ecd01200  Carbon metabolism
ecd01230  Biosynthesis of amino acids
Module
ecd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecd_M00002  Glycolysis, core module involving three-carbon compounds
ecd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECDH10B_4108 (tpiA)
   00051 Fructose and mannose metabolism
    ECDH10B_4108 (tpiA)
   00562 Inositol phosphate metabolism
    ECDH10B_4108 (tpiA)
Enzymes [BR:ecd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECDH10B_4108 (tpiA)
Exosome [BR:ecd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECDH10B_4108 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECDH10B_4108 (tpiA)
  Exosomal proteins of melanoma cells
   ECDH10B_4108 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB04931
UniProt: B1XB85
Structure
PDB: 

Jmol
Position
complement(4208460..4209227)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtatatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaatgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccggatatcgacggcgcgctggttggtggtgcttctctgaaagctgac
gccttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system