KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0450Help
Entry
Z0450             CDS       T00044                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Z0450 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Z0450 (mhpF)
   00650 Butanoate metabolism
    Z0450 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Z0450 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Z0450 (mhpF)
   00622 Xylene degradation
    Z0450 (mhpF)
   00621 Dioxin degradation
    Z0450 (mhpF)
Enzymes [BR:ece01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Z0450 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431523..432473
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEEN
VDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacgatcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgcggctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggagaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggtgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcgcga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattatcgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggatat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggttaatttgccg
ggcgtagggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcagaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system