KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0876Help
Entry
Z0876             CDS       T00044                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00020  Citrate cycle (TCA cycle)
ece00190  Oxidative phosphorylation
ece00650  Butanoate metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
Module
ece_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ece_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ece_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Z0876 (sdhD)
   00650 Butanoate metabolism
    Z0876 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Z0876 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AAG55046
UniProt: Q8X9A9
Structure
PDB: 

Jmol
Position
833859..834206
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgagctgacatatgaagtctggatcggtttctgcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system