KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0881Help
Entry
Z0881             CDS       T00044                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2 component)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00020  Citrate cycle (TCA cycle)
ece00310  Lysine degradation
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
Module
ece_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ece_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Z0881 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Z0881 (sucB)
Enzymes [BR:ece01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Z0881 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AAG55051
UniProt: P0AFG7
Structure
PDB: 

Jmol
Position
839821..841038
Genome map
AA seq 405 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVP
MTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVK
AVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIK
ELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNG
QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagccgatgccaccgtc
gcaacctggcataaaaaacccggtgacgcagtcgtacgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcagacggcattctggatgcggtt
ctggaagatgaaggtacaacggtaacgtctcgtcagatccttggtcgcctgcgtgaaggc
aacagcgccggtaaagaaaccagcgccaaatctgaagagaaagcgtccactccggcgcaa
cgccagcaggcgtctctggaagagcaaaacaacgatgcgttaagcccggcgatccgtcgc
ctgctggctgaacataacctcgacgccagcgccattaaaggcaccggtgtgggtggtcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaagctccggcgaaagagtctgcaccg
gcagcggctgctccggcggcgcaaccggctctggctgcacgtagcgaaaaacgtgtcccg
atgactcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgcc
atgctgaccacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtac
ggtgaagcgtttgaaaaacgccacggcatccgtctgggctttatgtccttctacgtgaaa
gcggtggttgaagccctgaaacgttacccggaagtgaatgcttctatcgacggcgatgac
gtggtttaccacaactatttcgacgtcagcatggcggtttctacgccgcgcggcctggtg
acgccggtactgcgtgatgtcgataccctcggcatggcagacatcgagaagaaaatcaaa
gagctggcagttaaaggccgtgacggcaagctgacggttgaagatctgaccggtggtaac
ttcaccatcaccaacggtggtgtgttcggttccctgatgtctacgccgatcatcaacccg
ccgcagagcgcaattctgggtatgcacgctatcaaagatcgtccgatggctgtgaatggt
caggttgagatcctgccgatgatgtacctggcgctgtcctacgatcaccgtctgatcgat
ggtcgcgaatccgtgggcttcctggtaacgatcaaagagttgctggaagatccgacgcgt
ctgctgctggacgtgtag

DBGET integrated database retrieval system