KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z1465Help
Entry
Z1465             CDS       T00044                                 

Gene name
stx2B
Definition
shiga-like toxin II B subunit encoded by bacteriophage BP-933W
Orthology
K11007  
shiga toxin subunit B
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Pathogenic Escherichia coli infection
Module
EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:ece00001]
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    Z1465 (stx2B)
Bacterial toxins [BR:ece02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    Z1465 (stx2B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1353261..1353530
Genome map
AA seq 89 aa AA seqDB search
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system