KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z1602Help
Entry
Z1602             CDS       T00044                                 

Definition
hypothetical protein
Orthology
K07484  
transposase
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1488312..1488674)
Genome map
AA seq 120 aa AA seqDB search
MFSGLFAMLTPDNVFLVVKPVDMRRGIDTLTQYVQNELNAAWHDGAAFVFTNKVRSRIKV
LRWDKHGVWLCTRRLHRGSFRWPRKGDATWHLTQDEFHWLVFGVDWQQVKGHDLAKWVYQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgttttccgggctcttcgccatgctgacgcctgataacgtattcctggtcgtaaaaccc
gtcgatatgcgccggggtatcgacacactgacacagtacgtccagaacgaacttaacgct
gcatggcatgacggtgctgcttttgtcttcaccaataaagtccgctcccgcataaaagtt
ctccggtgggacaaacatggcgtatggctgtgtacccgacgactgcaccggggaagcttc
cgctggccccggaaaggtgatgccacatggcatctcacacaggatgagtttcactggctg
gtctttggggttgactggcaacaggtgaaagggcatgacctggcaaaatgggtataccag
taa

DBGET integrated database retrieval system