KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2475mHelp
Entry
Z2475m            CDS       T00044                                 

Gene name
ycjM
Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Z2475m (ycjM)
Enzymes [BR:ece01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Z2475m (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(join(2207458..2208810,2208810..2209136))
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASESGXWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MDDNSTRHLWTTFSDDQIDLNYRSPDVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDDIAPGTVIITETNVPHKDNIAYFGEGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCQWAQSLSLPSGKTTWFNFLASHDGIGLNPLRGLLPESEILALVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSEEITRELNDEATLRHAVYHELSRLITLR
RSHNEFHPDNNFTIDTVNSSVMRIQRSNAEGNCLTGLFNVSKNIQHVNITGLHGRDLISE
VDILGNKITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagt
aatgatttaaaaccactacccacatttaatcagttttaccatcaatggctgcaaagcatt
ttttcacatgttcatttattacctttttatccatggtcatctgatgatggattttcggta
attgattatcatcaggtcgccagtgaaagcgggtagtggcaggatattcagcagctcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgcggttgatccg
caaaccgatctcagcgctgtcacccgtccgcgtgcattaccgctattaacgccgtttcaa
atggatgataattccacgcgccatttatggaccacctttagcgacgatcaaattgacctg
aattaccgtagccctgacgtgttgctggcgatggtggatgttttgctttgttacctggaa
aagggcgcagaatatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
gacatcgcgccaggtacggtgattattactgagacgaatgttccgcataaagataacatt
gcttactttggcgaaggcgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgttacatgcggtgcaaaaacagaacgtcgaggcgctgtgccagtgggcgcaaagt
ctgagcttgccctccggtaaaacgacctggtttaacttcctcgcctctcacgatggcatc
gggctgaacccactgcggggcttgttaccagaaagcgaaatattagcgctggtcgaggca
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacgcgcagtccc
tatgaaataaatgtcacctatatggatgcgttaagccgccgcgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattctgggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaatatcacagtgaagagataacccgagaactgaac
gatgaagctacattaaggcatgcggtatatcatgagttgtcgcgtttaattacacttcgt
cgcagccataacgagtttcatccggataataattttaccatcgatacggttaattcatcc
gtaatgcgtattcaaagaagtaacgcagagggtaattgtctgaccggattgtttaatgtc
agtaaaaatattcagcatgtaaatattactggcctgcacggtcgggatctgattagtgaa
gttgatatattgggtaataaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system