KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2549Help
Entry
Z2549             CDS       T00044                                 

Gene name
trpC
Definition
(GenBank) N-(5-phosphoribosyl)anthranilate isomerase and indole-3-glycerolphosphate synthetase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01130  Biosynthesis of antibiotics
ece01230  Biosynthesis of amino acids
Module
ece_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Z2549 (trpC)
Enzymes [BR:ece01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Z2549 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Z2549 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAG56554
UniProt: Q8X7B7
Structure
PDB: 

Jmol
Position
2266369..2267730
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVEARKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVICDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLKMGVLTEVSNEEELERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFADGFLIGSAL
MAHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVLDKAKVLSLVAVQLHGNEDQLYIDTLREALPAHVAIWKAL
SVGETLPARELQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgc
aaacagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttt
tatgatgcgctacagggtgcgcgcacggcgtttattctggagtgcaagaaagcgtcgccg
tcaaaaggcgtgatctgtgatgatttcgatccagcacgcattgccgccatttataaacat
tacgcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttc
ctccccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgac
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaacaatatcgccagcttgccgccgtcgcccacagtctgaagatgggt
gtgctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaag
gtcgttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtgacggtaatcagcgaatcaggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctgacggttttctaattggttcggcgttg
atggcccatgacgatttgcacgccgccgtgcgtcgggtgttgctgggtgagaataaagta
tgtggcctgacgcgtgggcaagatgctaaagcagcgtacgacgcgggcgcgatttacggt
gggttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
ctggacaaagctaaggtgttatcactggtggcagtgcaactgcatggtaatgaagatcag
ctgtatatcgatacgctgcgtgaagctctgccagcacacgttgccatctggaaagcatta
agcgtcggtgaaaccctgcccgcccgcgagcttcagcacgttgataaatatgttttagac
aacggccagggtggaagcgggcaacgtttcgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system