KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2549Help
Entry
Z2549             CDS       T00044                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Z2549 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Z2549 (trpC)
Enzymes [BR:ece01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Z2549 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Z2549 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2266369..2267730
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVEARKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVICDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLKMGVLTEVSNEEELERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFADGFLIGSAL
MAHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVLDKAKVLSLVAVQLHGNEDQLYIDTLREALPAHVAIWKAL
SVGETLPARELQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgc
aaacagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttt
tatgatgcgctacagggtgcgcgcacggcgtttattctggagtgcaagaaagcgtcgccg
tcaaaaggcgtgatctgtgatgatttcgatccagcacgcattgccgccatttataaacat
tacgcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttc
ctccccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgac
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaacaatatcgccagcttgccgccgtcgcccacagtctgaagatgggt
gtgctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaag
gtcgttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtgacggtaatcagcgaatcaggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctgacggttttctaattggttcggcgttg
atggcccatgacgatttgcacgccgccgtgcgtcgggtgttgctgggtgagaataaagta
tgtggcctgacgcgtgggcaagatgctaaagcagcgtacgacgcgggcgcgatttacggt
gggttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
ctggacaaagctaaggtgttatcactggtggcagtgcaactgcatggtaatgaagatcag
ctgtatatcgatacgctgcgtgaagctctgccagcacacgttgccatctggaaagcatta
agcgtcggtgaaaccctgcccgcccgcgagcttcagcacgttgataaatatgttttagac
aacggccagggtggaagcgggcaacgtttcgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system