KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2913Help
Entry
Z2913             CDS       T00044                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ece00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Z2913 (ruvA)
Enzymes [BR:ece01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Z2913 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2622503..2623114)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagagcgcacgttgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcactggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacgtctcctgccagcccggcgaccgacgatgctgaa
caagaagcggttgccgcgctggtggcgctgggctataaaccacaagaagcaagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system