KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3008Help
Entry
Z3008             CDS       T00044                                 

Gene name
yedO
Definition
(GenBank) putative 1-aminocyclopropane-1-carboxylate deaminase
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Z3008 (yedO)
Enzymes [BR:ece01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Z3008 (yedO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2695976..2697058)
Genome map
AA seq 360 aa AA seqDB search
MTKKGAFTSAFFIYAFSACIMRKSQQHTSEAVMPLHNLTRFPRLEFIGAPTPLEYLPRFS
DYLGREIFIKRDDVTPMAMGGNKLRKLEFLAADALREGADTLITAGAIQSNHVRQTAAVA
AKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPNAQLEELATRVEA
QGFRPYVIPVGGSNALGALGYVESALEIAQQCEGAVNISSVVVASGSAGTHAGLAVGLEH
LMPESELIGVTVSRSVADQLPKVVNLQQAIAKELELTASVEILLWDDYFAPGYGVPNDEG
MEAVKLLARLEGILLDPVYTGKAMAGLIDGISQKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagggcgctttcactagcgccttttttatttacgcgttttcagcgtgcata
atgagaaaatcacaacaacacacatcggaggctgttatgccactgcataatttaacccgt
tttccacggctggagtttatcggcgcgccaacgccgctcgaatatctgccgcgcttttct
gattatctaggacgggaaattttcatcaaacgggatgacgtcacccccatggcaatgggc
ggcaataaattacgtaagctagaatttctcgcggcagatgctctgcgtgaaggtgccgat
acgctgattactgccggggcgatccagtctaaccatgtgcggcagactgccgcagtcgct
gccaaactcggtctgcactgcgtggcgctgctggaaaatcctattggcacaaccgcagaa
aactatttaaccaacggcaatcgcttgttgctggatctgttcaatacccagattgaaatg
tgcgacgcactgaccgatcccaatgcccaactggaagagctggcgacgcgagtcgaagca
caaggctttcgcccgtatgtcattccggttggcggttctaatgctcttggcgcgctaggt
tatgtggagagtgcgctggaaatcgcgcaacagtgtgaaggggcggttaatatttcatcg
gtggtagtcgcatcgggcagtgccggaactcacgccggactggctgttgggctggaacac
ctgatgcctgaaagcgaactgattggcgtgaccgtgtcgcgttccgttgccgatcaattg
ccgaaagtggttaacctacaacaggcgattgcgaaagaactggagctgaccgcatcagtg
gaaattttactctgggatgactattttgcacctggctacggcgtgccgaacgacgaaggc
atggaagcagtgaaattgctggcgcggctggaaggcattctgcttgatcctgtgtatacc
ggaaaagcgatggcgggtctgattgacggtatcagtcagaaacgcttcaaagatgaaggg
ccgattctgtttattcataccggcggcgcgcctgcgctgttcgcctatcatccccacgtt
tag

DBGET integrated database retrieval system