KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3205Help
Entry
Z3205             CDS       T00044                                 

Gene name
galF
Definition
(GenBank) homolog of Salmonella UTP--glucose-1-P uridyltransferase, probably a UDP-gal transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00040  Pentose and glucuronate interconversions
ece00052  Galactose metabolism
ece00500  Starch and sucrose metabolism
ece00520  Amino sugar and nucleotide sugar metabolism
ece01100  Metabolic pathways
ece01130  Biosynthesis of antibiotics
Module
ece_M00362  Nucleotide sugar biosynthesis, prokaryotes
ece_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Z3205 (galF)
   00052 Galactose metabolism
    Z3205 (galF)
   00500 Starch and sucrose metabolism
    Z3205 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    Z3205 (galF)
Enzymes [BR:ece01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Z3205 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: AAG57101
UniProt: P0AAB7
Position
complement(2857807..2858700)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctacgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggcgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggcaaagtcagccgcattgttgaatttatcgaaaagccggat
cagccgcagacgctggactcagacatcatggccgttggtcgatatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gccattgctgagctggcaaaaaaacaatccgttgatgcaatgctgatgactggcgacagt
tacgactgcggtaaaaaaatgggctatatgcaggcgtttgtgaagtatggactacgcaac
ttgaaagaaggggcgaagttccgcaaaggtatcgagaagctgttaagcgaataa

DBGET integrated database retrieval system