KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4119Help
Entry
Z4119             CDS       T00044                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ece00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3725282..3727057
Genome map
AA seq 591 aa AA seqDB search
MNKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGNPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatcagcttaccgaaaattggtatccgcccggttattgacggtcgtcgcatg
ggtgttcgtgagtcgcttgaagaacaaacaatgaatatggcgaaagctacggccgcactg
ctgaccgagaaactgcgccatgcctgcggagctgccgtcgagtgtgtcatttccgatacc
tgtatcgcgggtatggctgaagccgctgcttgcgaagaaaaattcagcagccagaatgta
ggcctcaccattacggtaacgccttgctggtgctatggcagtgaaaccatcgacatggat
ccaacccgcccgaaagccatttggggctttaacggcactgaacgtcccggcgctgtttac
ctggcagcggctctggcagctcacagccagaaaggcatcccggcattctccatttacggt
catgacgttcaggatgccgatgacacatcgattcctgccgatgttgaagaaaaactgctg
cgctttgcccgcgccggtttggccgtcgccagcatgaaaggtaaaagctatctgtcgctg
ggcggcgtttcgatgggtatcgccggttctattgttgatcacaacttctttgaatcctgg
ctgggaatgaaagtccaggcggtggatatgaccgaactgcgtcgccgtatcgatcagaag
atttacgacgaagccgaactggaaatggcactggcctgggctgataaaaacttccgctat
ggcgaagatgaaaataacaaacagtatcaacgcaatgccgagcaaagccgcgcagttctg
cgcgaaagtttactgatggcgatgtgtatccgcgacatgatgcaaggcaacagcaaactg
gccgatattggtcgcgtggaagaatcacttggctacaacgccatcgctgcgggcttccag
gggcaacgtcactggaccgatcaatatcccaatggtgacaccgccgaagcgatcctcaac
agttcatttgactggaatggcgtgcgcgaaccctttgtcgtggcgaccgaaaacgacagt
cttaacggcgtggcaatgctaatgggtcaccagctcaccggcaccgctcaggtatttgcc
gatgtgcgtacctactggtcaccagaagcaattgagcgtgtaacggggcataaactggat
ggactggcagaacacggcatcatccatttgatcaactccggttctgctgcgctggacggt
tcctgtaaacaacgcgacagcgaaggtaacccgacgatgaagccgcactgggaaatctct
cagcaagaggctgacgcttgcctcgccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggttactcttcccgcttccttaccgaaggcggcgtcccgttcaccatg
actcgtgtcaacatcatcaaaggcctgggaccggtactgcaaatcgcggaaggctggagc
gtggaattgccgaaggatgtgcatgacatcctcaacaaacgcaccaactcaacctggcca
accacytggtttgcaccgcgcctcaccggtaaagggccgtttacggatgtgtactcggta
atggcgaactggggcgctaaccatggggttctgaccatcggccacgttggcgcagacttt
atcactctcgcctccatgctgcgtatcccggtatgtatgcacaacgttgaagagaccaaa
gtgtatcgtccttctgcctgggctgcgcacggcatggatattgaaggccaggattaccgc
gcttgccagaactacggtccgttgtacaagcgttaa

DBGET integrated database retrieval system