KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4231Help
Entry
Z4231             CDS       T00044                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3843569..3844279)
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFXDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggcttcgctcaggct
gatgacgcggcaattcaacaaacattagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcccgtagctggcatgaagactgtgctgactaacagcggtgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagcggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcaccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgaacaaatggcagactataacgcgctggggatcaccgtgcgttat
cttgctttcccacgccaggggctggacagcgatgctgagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccagctgcgacgtggatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gagatgaaagaattcytcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system