KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4239Help
Entry
Z4239             CDS       T00044                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z4239 (bglA)
Enzymes [BR:ece01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Z4239 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3849000..3850439
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEXGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDSLFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINLEMKVGC
MLAMVPXYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDSD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaakgcggctggaacaaaggcggaaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaataaccaaagaagtcttgccaggcaaatac
tatccaaaccatgaagccgttgatttttatggtcactataaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgactctctgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttc
gcggaagtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcagtgaaagccgcgcgtcgcattaacctggagatgaaagtcggctgt
atgctggcgatggtgccgytctatccctactcatgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcgtatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatagcgat
ctcgatgtactgcgcgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtacca
aacccgtatgttaaagcatctgactggggctggcagattgatccggtgggtctgcgttac
gcactttgcgaactgtatgagcgttaccagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcagtaacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaagtgattgccagcaacggcgagaatctgtaa

DBGET integrated database retrieval system