KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4429Help
Entry
Z4429             CDS       T00044                                 

Gene name
ebgA
Definition
(GenBank) evolved beta-D-galactosidase, alpha subunit; cryptic gene
  KO
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Z4429 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Z4429 (ebgA)
Enzymes [BR:ece01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Z4429 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4029443..4032571
Genome map
AA seq 1042 aa AA seqDB search
MNGSDFSLPGGPMNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSGQW
NFHFFDHPLQVPEAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDN
PTGAYQRIFTLSDGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKT
GDNLLCVRVMQWADSTYVEDQDMWWSAGIFRDVYLVGKHLTHINDFTVRTDFDEAYCDAT
LSCEVVLENLAASPVVTTLEYTLFDGERVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSA
ESPYLYHLVMTLKDANGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRK
GRAVGMDRVEKDLQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANV
GDISRITDDPQWEKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDD
TRLVHYEEDRDAEVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQ
NVFYKHDCIQGHYVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTP
GPGLKEYKQVIAPVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKL
RDVAPNSEAPLQITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVP
FAPNNARPLTLEDDRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMI
DNHKQEYEGLWQPNHLQIMQEHLRDFAVEQSDGEVLIISRTVIAPPVFDFGMRCTYIWRI
AADGQVNVALSGERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDI
WRSTVDAIFENYPFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAA
QHCNELQRSDDITLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQ
SLASYEFGAGFFSTNLHSENKQ
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttccgatttctctctaccgggaggccctatgaatcgctgggaaaacattcag
ctcacccacgaaaaccgacttgcgccgcgtgcgtactttttttcatatgattctgttgcg
caagcgcgtacctttgcccgcgaaacgagcagcctgtttctgcccttaagcggtcagtgg
aatttccacttttttgaccatccgctgcaagtgccagaagccttcacytctgagttaatg
gctgactgggggcatattaccgtccccgccatgtggcaaatggaaggtcacggcaaactg
caatataccgacgaaggttttccgttccccatcgatgtgccgtttgttcccagcgataac
ccaaccggtgcctatcaacgtattttcaccctcagtgacggctggcagggtaaacagacg
ctgattaaatttgacggcgtcgaaacctattttgaagtctacgttaacggtcagtatgtg
ggtttcagcaagggcagtcgcctgaccgcagagtttgacatcagcgcgatggttaaaacc
ggcgacaacctgttgtgtgtgcgcgtgatgcagtgggcggactctacctacgtggaagac
caggatatgtggtggtcagcggggatcttccgcgatgtttatctggtcggaaaacaccta
acgcatattaacgatttcactgtgcgtaccgactttgacgaagcctattgcgatgccacg
ctttcctgcgaagtggtgctggaaaatctcgccgcctcccctgtcgtcacgacgctggaa
tataccctgtttgatggcgaacgcgtggtgcacagcagcgccattgatcatttggcaatt
gaaaaactgaccagcgccagctttgcttttactgtcgaacagccgcagcaatggtcagca
gaatccccttatctttaccatctggtcatgacgctgaaagacgccaacggcaacgttctg
gaagtggtgccacaacgcgttggcttccgtgatatcaaagtgcgcgacggtctgttctgg
atcaataaccgttatgtgatgctgcacggcgtcaaccgtcacgacaacgatcatcgcaaa
ggccgcgccgttggaatggatcgcgtcgagaaagatctccagttgatgaagcagcacaac
atcaactccgtgcgtaccgctcactacccgaacgatccgcgtttttacgaactgtgtgat
atctacggcctgtttgtgatggcggaaaccgacgtcgaatcgcacggctttgctaatgtc
ggcgatatcagccgtattaccgacgatccgcagtgggaaaaagtctacgtcgagcgcatt
gttcgccatattcacgcgcagaaaaaccatccgtcgatcatcatctggtcgctgggcaat
gaatccggctatggctgtaacatccgcgcgatgtaccacgcagcgaaggcgctggatgac
acgcgactggtgcattacgaagaagatcgcgatgctgaagtggtcgatattatttccacc
atgtacacccgcgtgccgctgatgaatgagtttggtgaatacccgcatccgaagccgcgc
atcatctgtgaatatgctcatgcgatggggaacggaccgggcgggctgacggagtaccag
aacgtcttctataagcacgattgtattcagggacattatgtttgggagtggtgcgaccac
gggatccaggcgcaggatgacaacggcaatgtctggtataaattcggcggcgactacggc
gactatcccaacaactataacttctgtcttgatggtttgatctattccgatcagacgccg
ggaccaggcctgaaagagtacaaacaggttatcgcgccggtaaaaatccacgcgctggat
ctgactcgcggcgagctgaaagtcgaaaataaactgtggtttaccacgctggatgactac
accctgcacgcagaggtgcgcgccgaaggtgaaacgctcgcgacgcaacagattaaactg
cgcgacgttgcgccgaacagcgaagcccccttgcagatcacgctgccgcagctggacgcc
cgcgaagcgttcctcaacattacggtgaccaaagattcccgcacccgctacagcgaagcc
gggcattctatcgccacttatcagttcccgctgaaggaaaacaccgcgcagcctgtacct
ttcgcaccgaataacgcccgtccgctgacgctggaagacgatcgtttgagctgtactgtt
cgcggctacaactttgcgatcaccttctcaaaaacgagtggtaaaccgacatcctggcag
gtaaatggcgaatcgctgctgacccgcgagccaaagatcaacttcttcaagccaatgatc
gacaaccacaagcaggagtacgaagggttgtggcagccgaatcatttgcagatcatgcag
gaacatctgcgcgactttgccgtagaacagagcgatggtgaagtgttgatcatcagccgc
acggttatagcaccgccggtgtttgacttcgggatgcgctgtacctacatctggcgcatc
gctgcagatggccaggttaacgtggcgctttccggcgagcgttacggcgactatccgcac
atcattccgtgcatcggtttcaccatggggattaacggcgaatacgatcaggtggcgtat
tacggtcgtggaccgggcgaaaactacgccgacagccagcaggctaacatcatcgatatc
tggcgcagcaccgtcgatgccatattcgagaactatccyttcccgcagaacaacggcaac
cgtcagcatgtccgctggacggcactgactaaccgccacggcaacggtctgctggtggtt
ccgcagcgcccaattaacttcagcgcctggcactatacccaggaaaacatccacgctgcc
cagcactgtaacgagctgcagcgcagtgatgacatcaccctgaatctcgaccaccagctg
cttggcctcggctccaattcctggggcagcgaggtgctggactcctggcgcgtctggttc
cgtgacttcagctacggctttacgttgctgccggtttctggcggagaagctaccgcgcaa
agcctggcgtcgtatgagttcggcgcagggttcttttccacaaatttgcacagcgagaat
aagcaatga

DBGET integrated database retrieval system