KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4539Help
Entry
Z4539             CDS       T00044                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Z4539 (folP)
Enzymes [BR:ece01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Z4539 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4133777..4134670)
Genome map
AA seq 297 aa AA seqDB search
MLRGFFLSIHTRDNIMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHAN
LMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRE
SAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYF
IEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIG
QLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctccggggttttttcttatcaattcataccagggataacatcatgaaactctttgcc
cagggtacttcactggaccttagccatcctcacgtaatggggatcctcaacgtcacgcct
gattccttttcggatggtggcacgcataactcgctgatagatgcggtgaaacatgcgaat
ctgatgatcaacgctggcgcgacgatcattgacgttggtggcgartccacgcggccaggg
gcggcggaagttagcgttgaagaagagttgcaacgtgttattcctgtggttgaggcaatt
gctcaacgcttcgaagtctggatctcggtcgatacatccaaaccagaagtcatccgtgag
tcagcgaaagttggcgctcacattattaacgatatccgctccctttccgaacctggcgct
ctggaggcggctgcagaaaccggtttaccggtttgtctgatgcatatgcagggaaatcca
aaaaccatgcaggaagccccgaagtatgacgatgtctttgcagaagtgaatcgctacttt
attgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagagaaattgttgctcgac
cccggattcggtttcggtaaaaatctctcccataactattcattactggcgcgcctggct
gaatttcaccatttcaacctgccgctgttggtgggtatgtcacgaaaatcgatgattggg
cagctgctgaacgtggggccgtccgagcgcctgagcggtagtctggcctgtgcggtcatt
gccgcaatgcaaggcgcgcacattattcgtgttcatgacgtcaaagaaaccgtagaagcg
atgcgagtggtggaagctactctgtctgcaaaggaaaacaaacgctatgagtaa

DBGET integrated database retrieval system