KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4931Help
Entry
Z4931             CDS       T00044                                 

Gene name
yhjA
Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
Enzymes [BR:ece01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Z4931 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4477154..4478551)
Genome map
AA seq 465 aa AA seqDB search
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLADKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKAQFLDVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctcacgtattaccgcgatcggcctggctggcgtcgcgatttgctattta
gggttatctggttatgtgtggtaccacgataataaacgcagtaaacaggccgatgttcag
gcatctgctgtcagtgaaaataataaggttttaggctttctccgcgaaaaaggatgcgac
tattgccacacgccttcggcagaattacccgcctattattatattcctggcgcgaaacag
ttgatggattacgacattaagcttggatataaatcttttaacctcgaggccgtgcgtgct
gctctgctggctgataaacccgtttcgcaaagcgatctgaataagattgaatgggtgatg
cagtatgaaactatgccgccaacgcgttataccgcgctacactgggcgggtaaggtgagt
gatgaagagcgggcggaaatactggcctggattgcaaaacagcgcgcggaatattacgcc
agcaatgatactgctccggagcatcgcaatgaaccggtgcagcccatcccgcaaaaactg
cctaccgatgcgcaaaaagtggcgttgggctttgcgctgtatcacgatccccgtttatcg
gctgatagcaccatttcatgcgctcattgccatgcgttgaatgcggggggcgtcgatggc
agaaaaacatcgattggtgttggtggcgcagttgggccgattaacgcgccgacggtattt
aactcagtatttaacgttgagcagttctgggatggtcgtgcggcaacattgcaggatcag
gctggtggaccgccgttgaacccgattgaaatggcgtcaaaatcctgggacgaaattatt
gctaagctggaaaaagatccgcagcttaaagcgcagttcctcgacgtctatccgcaaggt
ttcagtggcgaaaatattactgatgccattgctgaatttgagaaaacattaattacgccg
gattccccatttgataaatggttgcgtggggatgaaaatgcgctgacggcgcaacagaaa
aaaggctatcaattatttaaagataataaatgtgcaacttgtcatggtggaattattctc
ggcggacgttccttcgaaccgttggggctgaaaaaagactttaactttggggaaattacg
gcggcggatattggtcgtatgaatgtgactaaagaagagcgtgataaattgcgtcagaaa
gtacccggtttacgtaacgttgctttaacggcaccgtacttccatcgcggtgacgtgccg
acgctggacggggcggtgaaactgatgttgcgctatcaggtaggcaaagagctgccgcag
gaggatgtggatgatatcgtagctttcctgcacagtctgaacggggtttacacgccgtat
atgcaggataaacaataa

DBGET integrated database retrieval system