KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5342Help
Entry
Z5342             CDS       T00044                                 

Gene name
pldA
Definition
(GenBank) outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00564  Glycerophospholipid metabolism
ece00565  Ether lipid metabolism
ece00590  Arachidonic acid metabolism
ece00592  alpha-Linolenic acid metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Z5342 (pldA)
   00565 Ether lipid metabolism
    Z5342 (pldA)
   00590 Arachidonic acid metabolism
    Z5342 (pldA)
   00591 Linoleic acid metabolism
    Z5342 (pldA)
   00592 alpha-Linolenic acid metabolism
    Z5342 (pldA)
Enzymes [BR:ece01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Z5342 (pldA)
    3.1.1.32  phospholipase A1
     Z5342 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AAG59017
UniProt: P0A922
Structure
PDB: 

Jmol
Position
4869936..4870805
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atctacacccaaaccagcgatctgaacaaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttcagacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggggttatgctaaacgatttgttttga

DBGET integrated database retrieval system