KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5367Help
Entry
Z5367             CDS       T00044                                 

Gene name
fadB
Definition
(GenBank) 4-enzyme protein: 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase; delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00071  Fatty acid degradation
ece00280  Valine, leucine and isoleucine degradation
ece00281  Geraniol degradation
ece00310  Lysine degradation
ece00362  Benzoate degradation
ece00380  Tryptophan metabolism
ece00410  beta-Alanine metabolism
ece00640  Propanoate metabolism
ece00650  Butanoate metabolism
ece00903  Limonene and pinene degradation
ece00930  Caprolactam degradation
ece01040  Biosynthesis of unsaturated fatty acids
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
ece01212  Fatty acid metabolism
Module
ece_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Z5367 (fadB)
   00650 Butanoate metabolism
    Z5367 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Z5367 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Z5367 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Z5367 (fadB)
   00310 Lysine degradation
    Z5367 (fadB)
   00380 Tryptophan metabolism
    Z5367 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Z5367 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Z5367 (fadB)
   00281 Geraniol degradation
    Z5367 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Z5367 (fadB)
   00930 Caprolactam degradation
    Z5367 (fadB)
Enzymes [BR:ece01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Z5367 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Z5367 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Z5367 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Z5367 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AAG59040
UniProt: Q8X8I2
Position
complement(4893666..4895855)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLALGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFERVDVVVEAIVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWHYKEDSKGXP
KKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaatggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattaccgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactgattgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacggcaggaaaacattacccggcccccatcaccgcagtaaaaaccattgaagct
gcggctcgttttggtcgtgaagaagccttaaacctagaaaacaaaagctttgtcccgctg
gcgcataccaacgaagctcgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgccgtgctgggc
gcaggcattatgggtggcggcatcgcttaccagtctgcgtggaaaggcgtgccggtgatt
atgaaagatattaacgacaagtcgttagccctcggcatgactgaagccgcgaaactactg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccacg
atccacccaacgctcgactacgccggatttgagcgcgtggatgttgtggtagaagcgatt
gttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgtccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgttg
gtggaaattattcgcggcgagaaaagctccgacgaaactattgcgaaagtcgtcgcctgg
gcgagcaagatgggtaaaacgccgattgtggttaacgattgccccggcttcttcgtcaac
cgcgtgctgttcccgtatttcgccggtttcagccagttgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggcctatgggtccggcatatctg
ctggacgttgtgggcattgacaccgcgcatcacgcccaggcagtcatggcagcgggcttc
ccacagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcattataaagaagacagcaaaggtwagccg
aagaaagaagaagacgccgctgttgacgacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggcagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtacgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system