KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5464Help
Entry
Z5464             CDS       T00044                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Z5464 (tpiA)
   01230 Biosynthesis of amino acids
    Z5464 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z5464 (tpiA)
   00051 Fructose and mannose metabolism
    Z5464 (tpiA)
   00562 Inositol phosphate metabolism
    Z5464 (tpiA)
Enzymes [BR:ece01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Z5464 (tpiA)
Exosome [BR:ece04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Z5464 (tpiA)
  Exosomal proteins of bladder cancer cells
   Z5464 (tpiA)
  Exosomal proteins of melanoma cells
   Z5464 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4979463..4980230)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgtgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagarcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcaratcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcattcgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcgtctctgaaagctgac
gctttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system