KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5601Help
Entry
Z5601             CDS       T00044                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00630  Glyoxylate and dicarboxylate metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01200  Carbon metabolism
Module
ece_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Z5601 (aceA)
Enzymes [BR:ece01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Z5601 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAG59207
UniProt: Q8X608
Structure
PDB: 

Jmol
Position
5094238..5095557
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWR
LLHGESKKGYINSLGALTGGQALQQAKAGIEXVYLSGWQVAADANLAASMYPDQSLYPAN
SVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDA
DAADLITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFAEAIHAKYPGKLLAYNCSPSFNWQKNLDDNTIASFQQQLSDMGYKFQFITLAGI
HSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacacaacaaattgaagaattacagaaagagtgg
actcaaccgcgttgggaaggaattactcgcccatacagcgcggaagatgtggtgaaatta
cgcggttcagtcaatcctgaatgcacgctggcgcaactgggcgcggcgaaaatgtggcgt
ctgctgcatggcgagtcgaaaaaaggctacatcaacagcctcggtgcactgactggcggt
caggcgctgcaacaggcgaaagcgggtattgaascggtctatctgtcgggatggcaggta
gcggcggacgctaacctggcggccagcatgtatccggatcagtcgctctatccggcaaac
tcggtgccagctgtggtggagcggatcaacaacactttccgccgtgcggatcagatccaa
tggtccgcgggcattgagccgggcgatccgcgctatgtcgattacttcctgccgatcgtt
gccgacgcggaagccggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatg
attgaagccggtgcagcggcagttcacttcgaagatcagctggcgtcagtgaagaaatgc
ggtcacatgggcggcaaagttttggtgccaactcaggaagctattcagaaactggtcgcg
gcgcgtctggcagctgacgtgacgggcgttccaaccctgctggttgcacgtaccgatgct
gatgcggcggatctgatcacctccgattgcgacccgtatgacagcgaatttattaccggc
gagcgtaccagtgaaggcttcttccgtactcatgcgggcattgagcaagcgatcagccgt
ggcctggcgtatgcgccatatgctgacctggtatggtgtgaaacctccacgccggatctg
gaactggcgcgtcgctttgcggaagctatccacgcgaaatatccgggcaaactgctggct
tataactgctcgccgtcgttcaactggcagaaaaacctcgacgacaacactattgccagc
ttccagcagcagctgtcggatatgggctacaagttccagttcatcaccctggcaggtatc
cacagcatgtggttcaacatgtttgatctggcaaacgcctatgcccagggcgagggtatg
aagcactatgttgagaaagtgcagcagccggaattcgccgccgcgaaagatggctacacc
ttcgtatctcaccagcaggaagtgggtacaggttacttcgataaagtgacgaccattatt
cagggcggcacgtcgtcggttaccgcgctgactggctccaccgaagaatcgcagttctaa

DBGET integrated database retrieval system