KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5973Help
Entry
Z5973             CDS       T00044                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Z5973 (holD)
   00240 Pyrimidine metabolism
    Z5973 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Z5973 (holD)
   03430 Mismatch repair
    Z5973 (holD)
   03440 Homologous recombination
    Z5973 (holD)
Enzymes [BR:ece01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Z5973 (holD)
DNA replication proteins [BR:ece03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Z5973 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5495843..5496256
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system