KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0052Help
Entry
ECH74115_0052     CDS       T00778                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ecf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54122..54712
Genome map
AA seq 196 aa AA seqDB search
MDSPAEYKIFLNIILAPVDDGLRFTYSGDNFFYREISMISLIAALAVDRVIGMENAMPWN
LPADLAWFKRNTLNKPVIMGRHTRESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIA
ACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDA
DAQNSHSYCFEILERR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtggactcgccagcagaatataaaattttcctcaacatcatcctcgcaccagtcgacgac
ggtttacgctttacgtatagtggcgacaattttttttatcgggaaatctcaatgatcagt
ctgattgcggcgttagcggtagatcgcgttatcggcatggaaaacgccatgccgtggaac
ctgcctgccgatctcgcctggtttaaacgcaacaccttaaataaacccgtaattatgggc
cgccataccagggaatccatcggtcgtccgttgccaggacgcaaaaatattatcctcagc
agtcaaccgggtacggacgatcgcgtaacgtgggtgaagtcggtggatgaagccatcgcg
gcgtgtggtgacgtaccagaaatcatggtgattggcggcggtcgcgtttatgagcagttc
ctgccgaaagcgcaaaaactgtacctgacgcatatcgacgcagaagtggaaggcgacacc
cattttccggattacgagccggatgactgggaatcggtattcagcgaattccacgacgct
gatgcgcagaactctcacagctattgttttgagattctggagcggcggtaa

DBGET integrated database retrieval system